Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IZ42

Protein Details
Accession A0A395IZ42    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKAPKRATKARTEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
3-27KEKAPKRATKARTEKKKKDPNAPKR
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKEKAPKRATKARTEKKKKDPNAPKRGLSAYMFFANEQRDNVREENPGISFGQVGKVLGERDKKRYEEEKAKLQRRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.87
4 0.88
5 0.92
6 0.89
7 0.88
8 0.89
9 0.89
10 0.89
11 0.84
12 0.76
13 0.69
14 0.64
15 0.56
16 0.46
17 0.37
18 0.28
19 0.24
20 0.22
21 0.18
22 0.18
23 0.17
24 0.16
25 0.15
26 0.13
27 0.12
28 0.15
29 0.16
30 0.16
31 0.15
32 0.16
33 0.17
34 0.16
35 0.17
36 0.14
37 0.12
38 0.11
39 0.1
40 0.11
41 0.09
42 0.09
43 0.08
44 0.1
45 0.11
46 0.16
47 0.24
48 0.26
49 0.33
50 0.39
51 0.4
52 0.46
53 0.52
54 0.57
55 0.58
56 0.62
57 0.65
58 0.7