Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IJ10

Protein Details
Accession A0A395IJ10    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKAAKKKVQGPKKKEVLSTBasic
NLS Segment(s)
PositionSequence
3-17KRKAAKKKVQGPKKK
Subcellular Location(s) mito 15, cyto_mito 13.5, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAAKKKVQGPKKKEVLSTTFPCLFCNHENSVIYATKSSRVLSTICRLPWMFMPNGSMLVIAVAKEADDRDFAPERAPARRQSGAAAKGDEDDEDNDDDIMGDEDGMGGYGGDGIVADDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.81
4 0.75
5 0.7
6 0.67
7 0.64
8 0.6
9 0.56
10 0.52
11 0.48
12 0.44
13 0.39
14 0.37
15 0.31
16 0.32
17 0.28
18 0.27
19 0.27
20 0.28
21 0.3
22 0.26
23 0.24
24 0.21
25 0.18
26 0.17
27 0.18
28 0.17
29 0.14
30 0.14
31 0.15
32 0.16
33 0.21
34 0.22
35 0.21
36 0.23
37 0.22
38 0.22
39 0.24
40 0.24
41 0.19
42 0.15
43 0.17
44 0.14
45 0.15
46 0.13
47 0.1
48 0.06
49 0.06
50 0.06
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.05
59 0.05
60 0.1
61 0.12
62 0.12
63 0.13
64 0.16
65 0.18
66 0.22
67 0.25
68 0.25
69 0.28
70 0.3
71 0.3
72 0.31
73 0.36
74 0.35
75 0.34
76 0.31
77 0.26
78 0.24
79 0.24
80 0.2
81 0.15
82 0.12
83 0.12
84 0.12
85 0.12
86 0.11
87 0.11
88 0.1
89 0.09
90 0.09
91 0.07
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03