Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IYD8

Protein Details
Accession A0A395IYD8   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
150-176KEIADEKRKQEKLKRREEEKRIEQIRRBasic
NLS Segment(s)
PositionSequence
138-186EEKRERSKEEKEKEIADEKRKQEKLKRREEEKRIEQIRRGRGRLEKRQS
Subcellular Location(s) nucl 21, mito_nucl 12.833, cyto_nucl 12.333, mito 3.5
Family & Domain DBs
Pfam View protein in Pfam  
PF05205  COMPASS-Shg1  
Amino Acid Sequences MASSYNKDSGMLGLRREESKDVRLPLASATRAAIEGLAHTYKKKGTYDELKTKIWQDLENGDFEEGFSRSLLNVAEEQLEKDPRQLLRLDRNKAMLLIEGAVDRAGPYQTAGARIEKLIQAYVPEIEKQRTREEERVEEKRERSKEEKEKEIADEKRKQEKLKRREEEKRIEQIRRGRGRLEKRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.33
4 0.35
5 0.3
6 0.34
7 0.39
8 0.37
9 0.37
10 0.36
11 0.33
12 0.32
13 0.33
14 0.27
15 0.22
16 0.19
17 0.18
18 0.17
19 0.17
20 0.13
21 0.08
22 0.08
23 0.1
24 0.12
25 0.12
26 0.13
27 0.15
28 0.17
29 0.21
30 0.22
31 0.22
32 0.28
33 0.37
34 0.46
35 0.53
36 0.55
37 0.53
38 0.53
39 0.52
40 0.48
41 0.4
42 0.32
43 0.24
44 0.25
45 0.24
46 0.23
47 0.22
48 0.18
49 0.16
50 0.15
51 0.14
52 0.09
53 0.08
54 0.07
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.09
63 0.09
64 0.1
65 0.11
66 0.13
67 0.12
68 0.13
69 0.16
70 0.14
71 0.16
72 0.18
73 0.2
74 0.28
75 0.35
76 0.38
77 0.36
78 0.37
79 0.35
80 0.33
81 0.29
82 0.19
83 0.12
84 0.09
85 0.07
86 0.06
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.06
96 0.07
97 0.09
98 0.1
99 0.11
100 0.12
101 0.12
102 0.13
103 0.12
104 0.12
105 0.1
106 0.09
107 0.09
108 0.09
109 0.1
110 0.1
111 0.11
112 0.13
113 0.16
114 0.19
115 0.21
116 0.26
117 0.32
118 0.37
119 0.41
120 0.44
121 0.5
122 0.54
123 0.58
124 0.58
125 0.57
126 0.55
127 0.58
128 0.57
129 0.55
130 0.53
131 0.57
132 0.61
133 0.62
134 0.66
135 0.61
136 0.6
137 0.57
138 0.61
139 0.58
140 0.56
141 0.57
142 0.57
143 0.63
144 0.66
145 0.69
146 0.7
147 0.73
148 0.75
149 0.78
150 0.8
151 0.8
152 0.86
153 0.88
154 0.88
155 0.87
156 0.87
157 0.84
158 0.8
159 0.77
160 0.76
161 0.76
162 0.75
163 0.69
164 0.65
165 0.67
166 0.71