Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IY68

Protein Details
Accession A0A395IY68    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
82-105GQPAKGGYKTRKVRKPNKWVVTLAHydrophilic
NLS Segment(s)
PositionSequence
64-72HGGGRGKSK
84-98PAKGGYKTRKVRKPN
Subcellular Location(s) mito 24, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR014722  Rib_L2_dom2  
IPR002171  Ribosomal_L2  
IPR022669  Ribosomal_L2_C  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF03947  Ribosomal_L2_C  
Amino Acid Sequences MIPIGTNVYNVGSAKGRGAVFCRSAGTYAVVVSKDDETSNKDKGPRFVTVRLQSGEVRKPTHPHGGGRGKSKGNVDPVSPWGQPAKGGYKTRKVRKPNKWVVTLAKEITERERTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.18
4 0.17
5 0.2
6 0.22
7 0.22
8 0.22
9 0.23
10 0.19
11 0.2
12 0.19
13 0.18
14 0.14
15 0.13
16 0.14
17 0.12
18 0.12
19 0.12
20 0.12
21 0.11
22 0.11
23 0.12
24 0.15
25 0.19
26 0.21
27 0.22
28 0.26
29 0.28
30 0.32
31 0.34
32 0.35
33 0.35
34 0.37
35 0.42
36 0.41
37 0.42
38 0.38
39 0.36
40 0.33
41 0.32
42 0.32
43 0.27
44 0.26
45 0.24
46 0.25
47 0.27
48 0.33
49 0.31
50 0.28
51 0.34
52 0.4
53 0.43
54 0.45
55 0.47
56 0.4
57 0.4
58 0.42
59 0.36
60 0.34
61 0.32
62 0.28
63 0.25
64 0.28
65 0.3
66 0.27
67 0.25
68 0.2
69 0.18
70 0.19
71 0.2
72 0.23
73 0.25
74 0.33
75 0.37
76 0.46
77 0.55
78 0.64
79 0.7
80 0.74
81 0.78
82 0.82
83 0.87
84 0.88
85 0.87
86 0.82
87 0.79
88 0.77
89 0.73
90 0.67
91 0.57
92 0.5
93 0.44
94 0.4
95 0.41