Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IY01

Protein Details
Accession A0A395IY01    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-40KTTEPNRNKKYDPKKPQHYRRTNYQGKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 6, mito_nucl 6, cyto 2, pero 2, E.R. 2, golg 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015876  Acyl-CoA_DS  
Gene Ontology GO:0016020  C:membrane  
GO:0016717  F:oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water  
GO:0006633  P:fatty acid biosynthetic process  
Amino Acid Sequences MASTASQPSSMAKTTEPNRNKKYDPKKPQHYRRTNYQGKLVQHVNWLNITLIVGVPIYGLIMAYWTPLQWKTAVWAVLYYFMTGLGITAGKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.4
3 0.45
4 0.51
5 0.56
6 0.61
7 0.64
8 0.67
9 0.72
10 0.73
11 0.76
12 0.77
13 0.82
14 0.86
15 0.92
16 0.93
17 0.92
18 0.86
19 0.86
20 0.85
21 0.82
22 0.74
23 0.71
24 0.65
25 0.56
26 0.56
27 0.48
28 0.38
29 0.35
30 0.34
31 0.26
32 0.21
33 0.2
34 0.15
35 0.13
36 0.12
37 0.07
38 0.05
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.07
54 0.07
55 0.09
56 0.09
57 0.09
58 0.12
59 0.16
60 0.17
61 0.15
62 0.16
63 0.16
64 0.19
65 0.19
66 0.17
67 0.12
68 0.11
69 0.11
70 0.09
71 0.09
72 0.06