A0A395IY01

UniProt ID: A0A395IY01   Organism: Monilinia fructigena
Gene: DID88_002175   Protein: Uncharacterized protein
Length: 117 AA

Protein Details

• Accession: A0A395IY01
• Localization Confidence: Low
• Confidence Score: 5
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  13-40	KTTEPNRNKKYDPKKPQHYRRTNYQGKL	Hydrophilic

• Subcellular Location(s): mito 12, plas 6, mito_nucl 6, cyto 2, pero 2, E.R. 2, golg 2, cyto_pero 2
• Family & Domain DBs:
  • InterPro:
    • IPR015876 Acyl-CoA_DS
  • Gene Ontology:
    • GO:0016020 C:membrane
    • GO:0016717 F:oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
    • GO:0006633 P:fatty acid biosynthetic process
• Amino Acid Sequences: MASTASQPSSMAKTTEPNRNKKYDPKKPQHYRRTNYQGKLVQHVNWLNITLIVGVPIYGLIMAYWTPLQWKTAVWAVLYYFMTGLGITAGKF

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.3
2, 0.4
3, 0.45
4, 0.51
5, 0.56
6, 0.61
7, 0.64
8, 0.67
9, 0.72
10, 0.73
11, 0.76
12, 0.77
13, 0.82
14, 0.86
15, 0.92
16, 0.93
17, 0.92
18, 0.86
19, 0.86
20, 0.85
21, 0.82
22, 0.74
23, 0.71
24, 0.65
25, 0.56
26, 0.56
27, 0.48
28, 0.38
29, 0.35
30, 0.34
31, 0.26
32, 0.21
33, 0.2
34, 0.15
35, 0.13
36, 0.12
37, 0.07
38, 0.05
39, 0.04
40, 0.04
41, 0.03
42, 0.03
43, 0.03
44, 0.03
45, 0.02
46, 0.02
47, 0.02
48, 0.03
49, 0.03
50, 0.04
51, 0.04
52, 0.04
53, 0.07
54, 0.07
55, 0.09
56, 0.09
57, 0.09
58, 0.12
59, 0.16
60, 0.17
61, 0.15
62, 0.16
63, 0.16
64, 0.19
65, 0.19
66, 0.17
67, 0.12
68, 0.11
69, 0.11
70, 0.09
71, 0.09
72, 0.06