Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IRC3

Protein Details
Accession A0A395IRC3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-92NVQKNAKKKAEIRQKKHKSERBasic
NLS Segment(s)
PositionSequence
75-92KNAKKKAEIRQKKHKSER
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
Amino Acid Sequences MMIPAHSALKNSIYQTRTFNHVLVVTRSVNSASTISRTISNGLCPACRRPYDEKTIKWKVVTPEEVAQFKANVQKNAKKKAEIRQKKHKSER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.31
4 0.34
5 0.33
6 0.3
7 0.26
8 0.27
9 0.26
10 0.25
11 0.26
12 0.21
13 0.19
14 0.2
15 0.18
16 0.15
17 0.14
18 0.13
19 0.1
20 0.11
21 0.12
22 0.12
23 0.13
24 0.13
25 0.14
26 0.13
27 0.14
28 0.14
29 0.14
30 0.14
31 0.14
32 0.17
33 0.19
34 0.2
35 0.24
36 0.28
37 0.33
38 0.41
39 0.46
40 0.48
41 0.54
42 0.59
43 0.56
44 0.5
45 0.49
46 0.44
47 0.44
48 0.41
49 0.35
50 0.34
51 0.36
52 0.36
53 0.34
54 0.3
55 0.23
56 0.22
57 0.27
58 0.27
59 0.29
60 0.35
61 0.42
62 0.5
63 0.6
64 0.63
65 0.62
66 0.64
67 0.67
68 0.72
69 0.75
70 0.76
71 0.77
72 0.83