Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J8X7

Protein Details
Accession A0A395J8X7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
50-76FKIERVQKERRGEERKRRGEERRGEEEBasic
NLS Segment(s)
PositionSequence
56-72QKERRGEERKRRGEERR
Subcellular Location(s) cyto_nucl 9.5, cyto 8, nucl 7, mito 5, plas 3, cysk 3
Family & Domain DBs
Amino Acid Sequences MVVALGQSIFIALSYVPMRMVVNEDQLLGIVFMSEPSQLLCLIDDPRQEFKIERVQKERRGEERKRRGEERRGEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.09
5 0.09
6 0.09
7 0.13
8 0.11
9 0.14
10 0.14
11 0.14
12 0.13
13 0.13
14 0.12
15 0.08
16 0.07
17 0.04
18 0.03
19 0.03
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.04
28 0.06
29 0.07
30 0.09
31 0.11
32 0.13
33 0.17
34 0.17
35 0.18
36 0.17
37 0.19
38 0.28
39 0.33
40 0.36
41 0.42
42 0.49
43 0.56
44 0.64
45 0.68
46 0.68
47 0.71
48 0.75
49 0.78
50 0.81
51 0.83
52 0.83
53 0.84
54 0.83
55 0.84
56 0.84
57 0.81