Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IWE0

Protein Details
Accession A0A395IWE0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-85QNRLNQRASRQRRKAEFRKLETHydrophilic
NLS Segment(s)
PositionSequence
75-76RR
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MFLTTLALLSSGYTTKPLPSMSITMNINEIPRIEVLPMPQRSQVQNHGEDWTGTSSTTMRRKLQNRLNQRASRQRRKAEFRKLETMTKAIKTQSPSSLTPHHHLQKTTCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.14
4 0.14
5 0.14
6 0.16
7 0.19
8 0.18
9 0.23
10 0.22
11 0.21
12 0.22
13 0.2
14 0.18
15 0.16
16 0.15
17 0.1
18 0.1
19 0.1
20 0.09
21 0.09
22 0.12
23 0.19
24 0.21
25 0.21
26 0.23
27 0.25
28 0.26
29 0.29
30 0.34
31 0.3
32 0.3
33 0.3
34 0.29
35 0.27
36 0.25
37 0.22
38 0.16
39 0.11
40 0.09
41 0.08
42 0.08
43 0.13
44 0.18
45 0.21
46 0.23
47 0.3
48 0.35
49 0.44
50 0.52
51 0.56
52 0.61
53 0.66
54 0.72
55 0.69
56 0.71
57 0.73
58 0.75
59 0.76
60 0.75
61 0.74
62 0.74
63 0.8
64 0.83
65 0.83
66 0.82
67 0.78
68 0.79
69 0.74
70 0.7
71 0.63
72 0.58
73 0.51
74 0.44
75 0.4
76 0.33
77 0.34
78 0.33
79 0.35
80 0.36
81 0.37
82 0.36
83 0.39
84 0.44
85 0.45
86 0.45
87 0.5
88 0.52
89 0.52
90 0.54