Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IS56

Protein Details
Accession A0A395IS56    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-100KDTASKKSKKSKSRVQENSDHydrophilic
NLS Segment(s)
PositionSequence
85-92SKKSKKSK
Subcellular Location(s) cyto 17.5, cyto_nucl 12.833, nucl 7, mito_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR039454  OM14  
IPR039453  OM14_C  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
GO:1990593  F:nascent polypeptide-associated complex binding  
Pfam View protein in Pfam  
PF17304  DUF5353  
Amino Acid Sequences MSYAQAVASGPQQTDEEKRAPAPPSVVPTESASTSSLIDVDTDSVHTVPSDFQSQPVQTETQANRLEQEAEEIEAKIRSAKDTASKKSKKSKSRVQENSDNPVVIGNAVAVAALSTGLGFGAYQKYAKGELTWKVVGAWAGVVGILAVGDYYLSSYLFKTKYPAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.25
4 0.25
5 0.27
6 0.3
7 0.32
8 0.31
9 0.3
10 0.28
11 0.31
12 0.33
13 0.31
14 0.28
15 0.29
16 0.28
17 0.25
18 0.23
19 0.19
20 0.16
21 0.15
22 0.14
23 0.11
24 0.09
25 0.08
26 0.07
27 0.07
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.09
37 0.12
38 0.11
39 0.13
40 0.17
41 0.17
42 0.18
43 0.19
44 0.18
45 0.14
46 0.22
47 0.21
48 0.25
49 0.27
50 0.25
51 0.24
52 0.24
53 0.24
54 0.17
55 0.18
56 0.11
57 0.1
58 0.1
59 0.1
60 0.1
61 0.09
62 0.09
63 0.09
64 0.08
65 0.08
66 0.08
67 0.09
68 0.17
69 0.22
70 0.28
71 0.37
72 0.41
73 0.46
74 0.56
75 0.63
76 0.64
77 0.67
78 0.7
79 0.7
80 0.77
81 0.8
82 0.77
83 0.78
84 0.72
85 0.71
86 0.62
87 0.52
88 0.4
89 0.32
90 0.25
91 0.15
92 0.11
93 0.05
94 0.03
95 0.03
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.04
108 0.06
109 0.06
110 0.07
111 0.08
112 0.09
113 0.11
114 0.11
115 0.12
116 0.15
117 0.19
118 0.24
119 0.24
120 0.23
121 0.22
122 0.23
123 0.21
124 0.16
125 0.12
126 0.07
127 0.06
128 0.06
129 0.05
130 0.04
131 0.03
132 0.03
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.03
139 0.04
140 0.05
141 0.06
142 0.07
143 0.13
144 0.15
145 0.16
146 0.21