Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IL18

Protein Details
Accession A0A395IL18    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
21-51GEKELQKKEKAERLAKKRKMNDGIPKIFKKRBasic
54-79IDPTIPSKPAPRPKKKSERASWIPIPHydrophilic
201-221GSKKLKPDEPKDKVKKRKAGDBasic
NLS Segment(s)
PositionSequence
27-73KKEKAERLAKKRKMNDGIPKIFKKRVKIDPTIPSKPAPRPKKKSERA
109-110KR
202-218SKKLKPDEPKDKVKKRK
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008895  Vps72/YL1  
IPR046757  YL1_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05764  YL1  
Amino Acid Sequences MDSSSDDDDQGPATGADDLEGEKELQKKEKAERLAKKRKMNDGIPKIFKKRVKIDPTIPSKPAPRPKKKSERASWIPIPEDAPTRASARGTTKKSKEQLHAQMIDREKKRLKQLANMEKAAAAKEAARKPAMTQEDRLAEAARVEKSNSKSLSRWEEAEQQREEEQRLKLAALHNRKLVGPVITWWSGRATWIGGKLIALGSKKLKPDEPKDKVKKRKAGDMEDESEVGSTESPAPKSISTTELVMADAPNGNKDSTSGVALGIANSDANKDGTLKQESKSSSNGILHLHPGTQPNSILKPPQPPTTSILQPPNQTSGVVPNISGLQPPQQTTGAVPNINGPLQLPQSHNHPVSNHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.1
8 0.1
9 0.12
10 0.18
11 0.21
12 0.27
13 0.32
14 0.37
15 0.44
16 0.52
17 0.58
18 0.63
19 0.7
20 0.74
21 0.81
22 0.83
23 0.84
24 0.84
25 0.85
26 0.83
27 0.82
28 0.82
29 0.81
30 0.82
31 0.81
32 0.81
33 0.76
34 0.76
35 0.71
36 0.69
37 0.67
38 0.68
39 0.67
40 0.68
41 0.7
42 0.72
43 0.76
44 0.74
45 0.67
46 0.61
47 0.59
48 0.6
49 0.62
50 0.63
51 0.65
52 0.69
53 0.77
54 0.85
55 0.88
56 0.9
57 0.89
58 0.89
59 0.85
60 0.85
61 0.8
62 0.72
63 0.64
64 0.55
65 0.46
66 0.37
67 0.33
68 0.26
69 0.21
70 0.19
71 0.19
72 0.19
73 0.19
74 0.21
75 0.25
76 0.33
77 0.38
78 0.45
79 0.49
80 0.56
81 0.62
82 0.66
83 0.64
84 0.65
85 0.67
86 0.66
87 0.66
88 0.59
89 0.59
90 0.58
91 0.59
92 0.51
93 0.49
94 0.46
95 0.46
96 0.53
97 0.54
98 0.51
99 0.51
100 0.6
101 0.64
102 0.65
103 0.6
104 0.52
105 0.46
106 0.43
107 0.35
108 0.25
109 0.15
110 0.11
111 0.18
112 0.2
113 0.22
114 0.22
115 0.21
116 0.22
117 0.29
118 0.33
119 0.28
120 0.27
121 0.28
122 0.29
123 0.3
124 0.3
125 0.23
126 0.16
127 0.16
128 0.16
129 0.13
130 0.12
131 0.13
132 0.17
133 0.19
134 0.26
135 0.26
136 0.26
137 0.26
138 0.31
139 0.37
140 0.33
141 0.33
142 0.29
143 0.37
144 0.38
145 0.42
146 0.37
147 0.31
148 0.32
149 0.31
150 0.3
151 0.25
152 0.22
153 0.18
154 0.18
155 0.17
156 0.17
157 0.2
158 0.25
159 0.28
160 0.3
161 0.29
162 0.3
163 0.3
164 0.28
165 0.25
166 0.19
167 0.12
168 0.11
169 0.13
170 0.13
171 0.13
172 0.12
173 0.12
174 0.11
175 0.11
176 0.1
177 0.08
178 0.08
179 0.1
180 0.1
181 0.09
182 0.09
183 0.09
184 0.09
185 0.1
186 0.09
187 0.09
188 0.12
189 0.15
190 0.17
191 0.19
192 0.23
193 0.27
194 0.36
195 0.45
196 0.49
197 0.57
198 0.66
199 0.74
200 0.8
201 0.82
202 0.81
203 0.73
204 0.75
205 0.72
206 0.69
207 0.67
208 0.62
209 0.56
210 0.49
211 0.46
212 0.36
213 0.29
214 0.22
215 0.14
216 0.08
217 0.06
218 0.08
219 0.1
220 0.11
221 0.12
222 0.13
223 0.13
224 0.15
225 0.16
226 0.15
227 0.14
228 0.15
229 0.15
230 0.14
231 0.14
232 0.12
233 0.1
234 0.09
235 0.1
236 0.09
237 0.1
238 0.1
239 0.1
240 0.1
241 0.1
242 0.12
243 0.11
244 0.12
245 0.1
246 0.09
247 0.11
248 0.11
249 0.1
250 0.08
251 0.07
252 0.06
253 0.06
254 0.07
255 0.06
256 0.07
257 0.07
258 0.09
259 0.11
260 0.16
261 0.22
262 0.24
263 0.24
264 0.29
265 0.32
266 0.33
267 0.34
268 0.31
269 0.3
270 0.3
271 0.31
272 0.27
273 0.26
274 0.26
275 0.24
276 0.22
277 0.19
278 0.22
279 0.21
280 0.21
281 0.22
282 0.23
283 0.25
284 0.26
285 0.29
286 0.29
287 0.36
288 0.39
289 0.45
290 0.44
291 0.43
292 0.45
293 0.46
294 0.47
295 0.45
296 0.49
297 0.45
298 0.47
299 0.47
300 0.47
301 0.41
302 0.36
303 0.31
304 0.28
305 0.29
306 0.25
307 0.22
308 0.19
309 0.2
310 0.2
311 0.2
312 0.16
313 0.18
314 0.21
315 0.23
316 0.25
317 0.24
318 0.24
319 0.25
320 0.32
321 0.3
322 0.28
323 0.26
324 0.27
325 0.29
326 0.29
327 0.27
328 0.2
329 0.19
330 0.22
331 0.26
332 0.24
333 0.23
334 0.3
335 0.38
336 0.4
337 0.38