Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IDT8

Protein Details
Accession A0A395IDT8   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-96KSQTPKVEPQEKKKRPKGRAAKREKFTRRFVNVBasic
NLS Segment(s)
PositionSequence
68-92PKVEPQEKKKRPKGRAAKREKFTRR
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR018243  Neuromodulin_palmitoyl_site  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
PROSITE View protein in PROSITE  
PS00412  NEUROMODULIN_1  
Amino Acid Sequences MLCCVRRASVKLPESIVIHHNDHRQPNTQQHSNRLSELSIDKHTDKPQSWERFTDPSLRAGKVKSQTPKVEPQEKKKRPKGRAAKREKFTRRFVNVTLTGGKRKMNPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.34
4 0.29
5 0.29
6 0.3
7 0.34
8 0.37
9 0.42
10 0.43
11 0.45
12 0.45
13 0.51
14 0.55
15 0.56
16 0.54
17 0.55
18 0.58
19 0.54
20 0.5
21 0.42
22 0.34
23 0.29
24 0.28
25 0.23
26 0.19
27 0.2
28 0.21
29 0.23
30 0.26
31 0.28
32 0.26
33 0.29
34 0.36
35 0.4
36 0.4
37 0.39
38 0.39
39 0.38
40 0.38
41 0.39
42 0.31
43 0.3
44 0.3
45 0.29
46 0.27
47 0.25
48 0.29
49 0.26
50 0.31
51 0.31
52 0.35
53 0.38
54 0.41
55 0.5
56 0.51
57 0.57
58 0.58
59 0.63
60 0.68
61 0.73
62 0.79
63 0.8
64 0.83
65 0.8
66 0.85
67 0.85
68 0.85
69 0.87
70 0.87
71 0.88
72 0.86
73 0.9
74 0.89
75 0.85
76 0.82
77 0.81
78 0.77
79 0.72
80 0.66
81 0.63
82 0.56
83 0.52
84 0.51
85 0.44
86 0.43
87 0.4
88 0.42
89 0.37