Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395J7L6

Protein Details
Accession A0A395J7L6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
205-228GVDPSKKAPTRKLRKIPRSGTPAMHydrophilic
NLS Segment(s)
PositionSequence
210-222KKAPTRKLRKIPR
Subcellular Location(s) plas 20, mito 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004299  MBOAT_fam  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03062  MBOAT  
Amino Acid Sequences MLPYIDAPFTYAAGILGASTDELKLITSFLLSYPFAGLLKRIPDSKPALKNLFIIGVSSFYLLGLFDLWGGTRTLAISSIGAYCIAKYVQGPFMPWIGFVFLMGHLSVNQLARQFVNDPGVVDITGAQMVLVMKLSAFCWNVADGRQPEAELSGFQKERAIKKLPGWFDFAGYVLFFPSLFAGPAFDYVDYKQWIETTMFEVPPGVDPSKKAPTRKLRKIPRSGTPAMWKAAAGLFWILLFLSFLRGTGLIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.07
11 0.06
12 0.07
13 0.06
14 0.06
15 0.07
16 0.07
17 0.11
18 0.1
19 0.1
20 0.11
21 0.12
22 0.12
23 0.11
24 0.12
25 0.12
26 0.16
27 0.18
28 0.2
29 0.2
30 0.26
31 0.33
32 0.41
33 0.44
34 0.48
35 0.49
36 0.48
37 0.48
38 0.42
39 0.38
40 0.29
41 0.23
42 0.16
43 0.13
44 0.12
45 0.11
46 0.1
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.06
59 0.05
60 0.06
61 0.06
62 0.07
63 0.07
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.06
71 0.07
72 0.07
73 0.06
74 0.06
75 0.09
76 0.12
77 0.12
78 0.13
79 0.13
80 0.15
81 0.15
82 0.14
83 0.12
84 0.09
85 0.08
86 0.07
87 0.07
88 0.05
89 0.06
90 0.06
91 0.06
92 0.05
93 0.06
94 0.07
95 0.07
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.1
102 0.1
103 0.12
104 0.11
105 0.11
106 0.11
107 0.11
108 0.09
109 0.08
110 0.07
111 0.05
112 0.05
113 0.04
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.03
120 0.03
121 0.04
122 0.04
123 0.06
124 0.07
125 0.07
126 0.08
127 0.08
128 0.09
129 0.1
130 0.14
131 0.12
132 0.14
133 0.14
134 0.14
135 0.13
136 0.13
137 0.13
138 0.09
139 0.1
140 0.12
141 0.12
142 0.13
143 0.16
144 0.19
145 0.22
146 0.27
147 0.3
148 0.28
149 0.34
150 0.41
151 0.41
152 0.39
153 0.41
154 0.36
155 0.31
156 0.29
157 0.24
158 0.18
159 0.13
160 0.12
161 0.07
162 0.06
163 0.05
164 0.05
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.08
172 0.09
173 0.08
174 0.09
175 0.1
176 0.15
177 0.15
178 0.15
179 0.14
180 0.14
181 0.15
182 0.15
183 0.15
184 0.15
185 0.17
186 0.17
187 0.16
188 0.17
189 0.15
190 0.17
191 0.2
192 0.18
193 0.15
194 0.16
195 0.23
196 0.32
197 0.37
198 0.38
199 0.44
200 0.54
201 0.64
202 0.73
203 0.78
204 0.79
205 0.85
206 0.91
207 0.88
208 0.86
209 0.83
210 0.77
211 0.73
212 0.7
213 0.64
214 0.56
215 0.5
216 0.4
217 0.33
218 0.3
219 0.24
220 0.16
221 0.12
222 0.1
223 0.09
224 0.09
225 0.08
226 0.06
227 0.07
228 0.05
229 0.09
230 0.08
231 0.09
232 0.1