Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395ISA1

Protein Details
Accession A0A395ISA1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-30VRPIVRRRALVRRQRARRWSFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVAGNWGFVRPIVRRRALVRRQRARRWSFLGLDGVGLVVEEVREDAAEGAEDDVEEAEGGGVAAAAGFAEGGEVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.53
4 0.59
5 0.64
6 0.68
7 0.71
8 0.77
9 0.82
10 0.86
11 0.81
12 0.78
13 0.74
14 0.68
15 0.59
16 0.52
17 0.45
18 0.34
19 0.28
20 0.21
21 0.15
22 0.09
23 0.07
24 0.04
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02