Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IL66

Protein Details
Accession A0A395IL66   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-25TPITNSDKKHSPKRKVFTGTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10.333, mito_nucl 9.499, mito 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006680  Amidohydro-rel  
IPR011059  Metal-dep_hydrolase_composite  
IPR032466  Metal_Hydrolase  
Gene Ontology GO:0016810  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds  
Pfam View protein in Pfam  
PF01979  Amidohydro_1  
Amino Acid Sequences MASHTPITNSDKKHSPKRKVFTGTFIQSKSLGELEIWRDTCVCVDEEGVIVKIAGVRGEQDVRECVEGLGWDSEEVGFEGSGGGLGERFFFPGFVDTHIHAPQYPNSGLFGSSTLLNWLNTYTFPSNPRSPPSPKPTPSTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.75
4 0.78
5 0.82
6 0.82
7 0.77
8 0.73
9 0.71
10 0.67
11 0.62
12 0.55
13 0.47
14 0.39
15 0.36
16 0.31
17 0.23
18 0.16
19 0.11
20 0.13
21 0.15
22 0.2
23 0.2
24 0.18
25 0.18
26 0.18
27 0.18
28 0.16
29 0.13
30 0.09
31 0.08
32 0.08
33 0.09
34 0.09
35 0.09
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.07
45 0.08
46 0.08
47 0.09
48 0.1
49 0.1
50 0.11
51 0.1
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.05
76 0.05
77 0.06
78 0.06
79 0.08
80 0.09
81 0.1
82 0.13
83 0.13
84 0.16
85 0.17
86 0.17
87 0.16
88 0.17
89 0.17
90 0.2
91 0.19
92 0.17
93 0.17
94 0.17
95 0.17
96 0.15
97 0.14
98 0.1
99 0.1
100 0.09
101 0.1
102 0.11
103 0.11
104 0.11
105 0.11
106 0.11
107 0.11
108 0.17
109 0.17
110 0.18
111 0.21
112 0.28
113 0.33
114 0.37
115 0.43
116 0.44
117 0.48
118 0.55
119 0.61
120 0.64
121 0.62
122 0.65