Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J031

Protein Details
Accession A0A395J031    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-62GLILKPRRMCFRKRNRQSKCCNVRETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVNVTPEKSSARNILENSQKLVDEIDIPQPIISAFEGLILKPRRMCFRKRNRQSKCCNVRETARGRPQRIGEVATKDIEEVIEGGHVAALIMLLSSEHLSVRKEALTNISKVRAKLKESPLKKRTGLASPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.46
4 0.45
5 0.41
6 0.36
7 0.31
8 0.29
9 0.22
10 0.15
11 0.15
12 0.17
13 0.16
14 0.16
15 0.15
16 0.14
17 0.13
18 0.13
19 0.11
20 0.07
21 0.06
22 0.09
23 0.09
24 0.09
25 0.17
26 0.18
27 0.19
28 0.22
29 0.24
30 0.31
31 0.35
32 0.44
33 0.47
34 0.57
35 0.67
36 0.74
37 0.82
38 0.83
39 0.88
40 0.89
41 0.89
42 0.88
43 0.83
44 0.76
45 0.68
46 0.62
47 0.6
48 0.56
49 0.54
50 0.52
51 0.51
52 0.5
53 0.5
54 0.47
55 0.43
56 0.39
57 0.33
58 0.27
59 0.24
60 0.24
61 0.21
62 0.19
63 0.16
64 0.15
65 0.12
66 0.09
67 0.05
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.03
82 0.03
83 0.04
84 0.05
85 0.06
86 0.08
87 0.09
88 0.11
89 0.12
90 0.13
91 0.14
92 0.21
93 0.23
94 0.25
95 0.28
96 0.33
97 0.34
98 0.35
99 0.43
100 0.41
101 0.42
102 0.48
103 0.56
104 0.58
105 0.64
106 0.73
107 0.71
108 0.73
109 0.7
110 0.66
111 0.61