Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CGW9

Protein Details
Accession A1CGW9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
29-49EYQQRKKKANYWKILQRRICYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
KEGG act:ACLA_045890  -  
Amino Acid Sequences MPASTQATGSKKDSIPRVSTLVPQSAVREYQQRKKKANYWKILQRRICYFQLDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.39
4 0.4
5 0.35
6 0.37
7 0.34
8 0.3
9 0.25
10 0.23
11 0.21
12 0.19
13 0.18
14 0.15
15 0.21
16 0.23
17 0.31
18 0.39
19 0.45
20 0.5
21 0.56
22 0.63
23 0.66
24 0.71
25 0.71
26 0.72
27 0.75
28 0.79
29 0.82
30 0.81
31 0.75
32 0.73
33 0.7
34 0.65