Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IUW6

Protein Details
Accession A0A395IUW6   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-98DGRLIPHPQKHSRKKGKPRNKITYNLHRYLBasic
NLS Segment(s)
PositionSequence
66-89PERDGRLIPHPQKHSRKKGKPRNK
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011006  CheY-like_superfamily  
IPR001789  Sig_transdc_resp-reg_receiver  
Gene Ontology GO:0000160  P:phosphorelay signal transduction system  
Pfam View protein in Pfam  
PF00072  Response_reg  
PROSITE View protein in PROSITE  
PS50110  RESPONSE_REGULATORY  
CDD cd17546  REC_hyHK_CKI1_RcsC-like  
Amino Acid Sequences MPNVDGLQSTRLIREMGYSAPIVALTAFAEESNVKECYESGMDHFLSKPIRRPALKQVLKKFATIPERDGRLIPHPQKHSRKKGKPRNKITYNLHRYLHLQNTPSSDSNPNLSKFSGTPSPPSPLTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.15
5 0.14
6 0.13
7 0.13
8 0.12
9 0.1
10 0.08
11 0.07
12 0.05
13 0.05
14 0.05
15 0.05
16 0.06
17 0.06
18 0.07
19 0.1
20 0.11
21 0.1
22 0.1
23 0.1
24 0.12
25 0.14
26 0.13
27 0.12
28 0.15
29 0.15
30 0.15
31 0.16
32 0.16
33 0.18
34 0.19
35 0.24
36 0.26
37 0.32
38 0.33
39 0.36
40 0.43
41 0.5
42 0.56
43 0.56
44 0.57
45 0.6
46 0.59
47 0.57
48 0.48
49 0.43
50 0.42
51 0.36
52 0.33
53 0.28
54 0.3
55 0.29
56 0.28
57 0.24
58 0.23
59 0.3
60 0.31
61 0.33
62 0.38
63 0.46
64 0.57
65 0.64
66 0.71
67 0.74
68 0.8
69 0.84
70 0.89
71 0.91
72 0.91
73 0.92
74 0.92
75 0.87
76 0.86
77 0.84
78 0.84
79 0.81
80 0.76
81 0.66
82 0.57
83 0.55
84 0.51
85 0.5
86 0.42
87 0.36
88 0.33
89 0.37
90 0.39
91 0.37
92 0.34
93 0.31
94 0.28
95 0.32
96 0.35
97 0.32
98 0.3
99 0.3
100 0.29
101 0.25
102 0.3
103 0.31
104 0.28
105 0.32
106 0.33
107 0.38
108 0.37