Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J956

Protein Details
Accession A0A395J956    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
136-166RSSGSAKKERERLKKEKEKAEKEPEPRHKTKBasic
NLS Segment(s)
PositionSequence
135-165RRSSGSAKKERERLKKEKEKAEKEPEPRHKT
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MTSKEKEKHGRSESGRRNTLQRMLDLENRNKLQRMQASTTSVGQPQHHLLPNVLPNQTIRSSHDCSNIIRCDTFTAEPRKAKPEPQASKNVVVAEPVKEMSPEANAADPEILMHLRYVVAARGMVVMGGREEWQRRSSGSAKKERERLKKEKEKAEKEPEPRHKTKWSIEQGTSINKHLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.68
4 0.68
5 0.64
6 0.64
7 0.56
8 0.48
9 0.43
10 0.43
11 0.49
12 0.5
13 0.5
14 0.5
15 0.51
16 0.51
17 0.48
18 0.45
19 0.44
20 0.43
21 0.44
22 0.42
23 0.43
24 0.45
25 0.44
26 0.44
27 0.38
28 0.34
29 0.3
30 0.25
31 0.24
32 0.22
33 0.26
34 0.27
35 0.26
36 0.24
37 0.25
38 0.29
39 0.3
40 0.27
41 0.22
42 0.2
43 0.23
44 0.24
45 0.21
46 0.2
47 0.23
48 0.27
49 0.29
50 0.34
51 0.32
52 0.31
53 0.36
54 0.34
55 0.3
56 0.26
57 0.23
58 0.2
59 0.21
60 0.21
61 0.2
62 0.24
63 0.27
64 0.3
65 0.32
66 0.36
67 0.34
68 0.37
69 0.39
70 0.44
71 0.45
72 0.47
73 0.53
74 0.5
75 0.51
76 0.48
77 0.41
78 0.3
79 0.25
80 0.21
81 0.14
82 0.12
83 0.1
84 0.09
85 0.08
86 0.08
87 0.07
88 0.07
89 0.07
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.05
101 0.05
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.04
115 0.05
116 0.06
117 0.09
118 0.11
119 0.14
120 0.16
121 0.17
122 0.17
123 0.22
124 0.29
125 0.34
126 0.41
127 0.48
128 0.55
129 0.61
130 0.69
131 0.73
132 0.76
133 0.78
134 0.79
135 0.8
136 0.82
137 0.84
138 0.86
139 0.87
140 0.85
141 0.85
142 0.85
143 0.83
144 0.81
145 0.84
146 0.84
147 0.83
148 0.79
149 0.76
150 0.74
151 0.73
152 0.72
153 0.72
154 0.71
155 0.69
156 0.66
157 0.66
158 0.62
159 0.63
160 0.58