Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IK61

Protein Details
Accession A0A395IK61   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-32LLWKIPWRLSKFQKARQRKRLRAVDSVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MSGGLLWKIPWRLSKFQKARQRKRLRAVDSVVATVDRALAAKGITTKAVESIQCLIEKRRNIEREFTSYQNGQDYHKGSILPVIDMDILGWTQWQVFSPEDLVYNMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.7
4 0.77
5 0.81
6 0.85
7 0.87
8 0.9
9 0.88
10 0.9
11 0.9
12 0.85
13 0.81
14 0.74
15 0.69
16 0.59
17 0.51
18 0.4
19 0.3
20 0.25
21 0.17
22 0.13
23 0.06
24 0.05
25 0.04
26 0.05
27 0.04
28 0.05
29 0.06
30 0.07
31 0.07
32 0.07
33 0.07
34 0.09
35 0.1
36 0.09
37 0.09
38 0.11
39 0.11
40 0.12
41 0.13
42 0.14
43 0.17
44 0.19
45 0.22
46 0.28
47 0.32
48 0.32
49 0.38
50 0.39
51 0.41
52 0.43
53 0.41
54 0.37
55 0.33
56 0.33
57 0.3
58 0.28
59 0.22
60 0.24
61 0.24
62 0.23
63 0.23
64 0.22
65 0.18
66 0.21
67 0.19
68 0.14
69 0.12
70 0.11
71 0.1
72 0.1
73 0.1
74 0.07
75 0.06
76 0.05
77 0.06
78 0.05
79 0.05
80 0.06
81 0.07
82 0.09
83 0.1
84 0.12
85 0.14
86 0.14
87 0.15