Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IWH5

Protein Details
Accession A0A395IWH5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
139-165ARYQEGRPKEKPPSRRKQKYLYQIQHLHydrophilic
NLS Segment(s)
PositionSequence
22-80EAPKTKKAAPKANTGKKVAPTKGAKPAGVKKAAAPKKKSTVAAKKLLWRRPRRLLRRGA
113-156KPAVEKPAVEKPAAEKAKKKAPAPKEARYQEGRPKEKPPSRRKQ
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MARVTRSSTGSIPVKPAPAPVEAPKTKKAAPKANTGKKVAPTKGAKPAGVKKAAAPKKKSTVAAKKLLWRRPRRLLRRGAEKAEEQVEETSEEETVEKPAVEKPAVEKPAVEKPAVEKPAVEKPAAEKAKKKAPAPKEARYQEGRPKEKPPSRRKQKYLYQIQHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.32
4 0.27
5 0.25
6 0.28
7 0.28
8 0.35
9 0.38
10 0.42
11 0.43
12 0.45
13 0.47
14 0.5
15 0.53
16 0.53
17 0.51
18 0.58
19 0.64
20 0.7
21 0.72
22 0.69
23 0.65
24 0.63
25 0.67
26 0.58
27 0.56
28 0.51
29 0.5
30 0.55
31 0.54
32 0.48
33 0.46
34 0.52
35 0.5
36 0.48
37 0.44
38 0.38
39 0.45
40 0.51
41 0.53
42 0.5
43 0.49
44 0.53
45 0.57
46 0.58
47 0.57
48 0.6
49 0.59
50 0.62
51 0.59
52 0.59
53 0.63
54 0.65
55 0.65
56 0.63
57 0.64
58 0.66
59 0.74
60 0.75
61 0.75
62 0.78
63 0.75
64 0.77
65 0.74
66 0.67
67 0.59
68 0.51
69 0.44
70 0.37
71 0.3
72 0.2
73 0.15
74 0.13
75 0.11
76 0.1
77 0.09
78 0.07
79 0.07
80 0.06
81 0.06
82 0.07
83 0.06
84 0.06
85 0.06
86 0.08
87 0.11
88 0.11
89 0.11
90 0.13
91 0.21
92 0.23
93 0.22
94 0.2
95 0.21
96 0.29
97 0.3
98 0.27
99 0.19
100 0.21
101 0.29
102 0.3
103 0.27
104 0.19
105 0.21
106 0.29
107 0.3
108 0.27
109 0.2
110 0.21
111 0.32
112 0.37
113 0.37
114 0.35
115 0.39
116 0.48
117 0.54
118 0.56
119 0.55
120 0.56
121 0.65
122 0.66
123 0.68
124 0.7
125 0.68
126 0.69
127 0.66
128 0.66
129 0.64
130 0.67
131 0.66
132 0.6
133 0.63
134 0.67
135 0.69
136 0.74
137 0.75
138 0.76
139 0.8
140 0.87
141 0.88
142 0.87
143 0.89
144 0.89
145 0.9