Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CL67

Protein Details
Accession A1CL67    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGDRSRSRSPRRRFDSDRDRPRKTGBasic
90-110KEDRREKKETKEKKEKKAVVTBasic
NLS Segment(s)
PositionSequence
6-106RSRSPRRRFDSDRDRPRKTGGGGFRWKDKRRDDDRPDAEDSRLNRGYRDRGERARSPRRERDSDRYRDRYRDGDRERKRPEDNEKEDRREKKETKEKKEKK
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
KEGG act:ACLA_041070  -  
Amino Acid Sequences MGDRSRSRSPRRRFDSDRDRPRKTGGGGFRWKDKRRDDDRPDAEDSRLNRGYRDRGERARSPRRERDSDRYRDRYRDGDRERKRPEDNEKEDRREKKETKEKKEKKAVVTPQSSEPMIVVHVNDRLGTRAAIPCLASDPIKLFKAQVAARIGREPHEILLKRQGERPFKDQLTLEDYGVSNGVQLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.86
4 0.87
5 0.86
6 0.83
7 0.76
8 0.73
9 0.69
10 0.61
11 0.59
12 0.55
13 0.56
14 0.59
15 0.59
16 0.64
17 0.67
18 0.69
19 0.69
20 0.69
21 0.69
22 0.69
23 0.77
24 0.75
25 0.77
26 0.77
27 0.74
28 0.71
29 0.63
30 0.55
31 0.49
32 0.42
33 0.4
34 0.38
35 0.33
36 0.3
37 0.33
38 0.38
39 0.4
40 0.47
41 0.45
42 0.47
43 0.53
44 0.59
45 0.64
46 0.67
47 0.7
48 0.7
49 0.73
50 0.74
51 0.75
52 0.75
53 0.76
54 0.75
55 0.76
56 0.76
57 0.76
58 0.72
59 0.68
60 0.64
61 0.62
62 0.58
63 0.58
64 0.57
65 0.59
66 0.62
67 0.67
68 0.69
69 0.66
70 0.64
71 0.6
72 0.62
73 0.62
74 0.63
75 0.63
76 0.64
77 0.64
78 0.68
79 0.67
80 0.62
81 0.61
82 0.57
83 0.57
84 0.62
85 0.65
86 0.68
87 0.74
88 0.78
89 0.78
90 0.85
91 0.8
92 0.75
93 0.75
94 0.73
95 0.69
96 0.65
97 0.57
98 0.5
99 0.47
100 0.41
101 0.32
102 0.24
103 0.15
104 0.13
105 0.11
106 0.08
107 0.07
108 0.09
109 0.09
110 0.09
111 0.09
112 0.1
113 0.1
114 0.1
115 0.11
116 0.12
117 0.12
118 0.13
119 0.13
120 0.11
121 0.13
122 0.14
123 0.12
124 0.11
125 0.13
126 0.16
127 0.17
128 0.17
129 0.15
130 0.15
131 0.22
132 0.22
133 0.25
134 0.26
135 0.28
136 0.29
137 0.33
138 0.32
139 0.28
140 0.3
141 0.26
142 0.22
143 0.29
144 0.29
145 0.28
146 0.37
147 0.4
148 0.38
149 0.43
150 0.5
151 0.49
152 0.54
153 0.55
154 0.55
155 0.51
156 0.53
157 0.49
158 0.45
159 0.42
160 0.38
161 0.34
162 0.27
163 0.26
164 0.23
165 0.22
166 0.17
167 0.12