Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395ILN0

Protein Details
Accession A0A395ILN0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
101-124DEAWSAPRRLRGQKTKRAPKMGRNHydrophilic
NLS Segment(s)
PositionSequence
108-124RRLRGQKTKRAPKMGRN
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MTRKLTQSPERRDAITFFYFSIREANRLVSTCVIKKTGIERIPAAMEENFKQNTKAKFMSAKSSRKSVRNVARNAMKTDKNIRSVWDEKDTYYENISEDEDEAWSAPRRLRGQKTKRAPKMGRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.4
3 0.32
4 0.25
5 0.25
6 0.23
7 0.22
8 0.26
9 0.21
10 0.2
11 0.2
12 0.23
13 0.23
14 0.24
15 0.25
16 0.21
17 0.24
18 0.24
19 0.26
20 0.24
21 0.21
22 0.22
23 0.25
24 0.29
25 0.28
26 0.28
27 0.26
28 0.26
29 0.27
30 0.25
31 0.23
32 0.15
33 0.15
34 0.13
35 0.17
36 0.16
37 0.16
38 0.18
39 0.21
40 0.22
41 0.25
42 0.25
43 0.24
44 0.28
45 0.29
46 0.36
47 0.38
48 0.43
49 0.4
50 0.46
51 0.48
52 0.46
53 0.49
54 0.49
55 0.5
56 0.52
57 0.53
58 0.52
59 0.55
60 0.53
61 0.53
62 0.49
63 0.42
64 0.38
65 0.44
66 0.42
67 0.4
68 0.38
69 0.37
70 0.38
71 0.4
72 0.4
73 0.38
74 0.34
75 0.3
76 0.33
77 0.34
78 0.28
79 0.26
80 0.23
81 0.16
82 0.17
83 0.17
84 0.14
85 0.12
86 0.11
87 0.1
88 0.1
89 0.09
90 0.11
91 0.13
92 0.14
93 0.16
94 0.23
95 0.29
96 0.38
97 0.48
98 0.56
99 0.64
100 0.73
101 0.82
102 0.86
103 0.88
104 0.9