Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395J444

Protein Details
Accession A0A395J444    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
64-83EEEEDAKPRTRSRRKKKDAEBasic
NLS Segment(s)
PositionSequence
70-81KPRTRSRRKKKD
Subcellular Location(s) nucl 19, mito 8
Family & Domain DBs
Amino Acid Sequences MLPRKIINPLMPRAPAEYNQPATFGSLPKSYGGFQSPNYNEPHVYVDPAKAQEDLKALLEGVIEEEEDAKPRTRSRRKKKDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.34
4 0.35
5 0.34
6 0.33
7 0.32
8 0.28
9 0.28
10 0.28
11 0.22
12 0.18
13 0.15
14 0.15
15 0.15
16 0.16
17 0.14
18 0.15
19 0.16
20 0.15
21 0.15
22 0.22
23 0.23
24 0.25
25 0.26
26 0.25
27 0.22
28 0.22
29 0.25
30 0.17
31 0.17
32 0.15
33 0.14
34 0.15
35 0.16
36 0.16
37 0.13
38 0.13
39 0.13
40 0.14
41 0.14
42 0.13
43 0.12
44 0.11
45 0.1
46 0.1
47 0.08
48 0.07
49 0.06
50 0.05
51 0.05
52 0.06
53 0.07
54 0.09
55 0.11
56 0.13
57 0.16
58 0.23
59 0.34
60 0.44
61 0.55
62 0.64
63 0.74