Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IE20

Protein Details
Accession A0A395IE20   
Localization Confidence High
Confidence Score 19.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-36PKGLDDGVKKPKNKKSKNNDADSEKKDBasic
141-166DLNTDGKTGKNKKKKKKLVGEIDDGNHydrophilic
NLS Segment(s)
PositionSequence
18-26KKPKNKKSK
148-157TGKNKKKKKK
Subcellular Location(s) nucl 20, cyto 4, mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MAFKSGQKLPKGLDDGVKKPKNKKSKNNDADSEKKDLQTPKKDPVTEIPKIRPGEKMWEFSARVDAALPVGGLIHKSAKGGKDPLGLKQGRTKTEKKMHRMYDEWREEERKIQEKRQEEAELREEDDMEMDGEGQMQWKSDLNTDGKTGKNKKKKKKLVGEIDDGNDDPWAIIAKNRGEVKAGLNDVVQAPPTFTKVPKAKFKELQGAKVEVSDVPKAAGSLRRREELGEVRKSIVESYRQMMKDNKDKVKSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.56
4 0.6
5 0.59
6 0.63
7 0.7
8 0.73
9 0.77
10 0.81
11 0.81
12 0.85
13 0.89
14 0.89
15 0.88
16 0.85
17 0.84
18 0.77
19 0.74
20 0.65
21 0.56
22 0.53
23 0.53
24 0.54
25 0.55
26 0.56
27 0.57
28 0.62
29 0.62
30 0.59
31 0.6
32 0.59
33 0.56
34 0.57
35 0.52
36 0.52
37 0.53
38 0.52
39 0.46
40 0.41
41 0.44
42 0.42
43 0.41
44 0.36
45 0.4
46 0.39
47 0.35
48 0.37
49 0.27
50 0.23
51 0.2
52 0.17
53 0.12
54 0.11
55 0.1
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.07
62 0.07
63 0.08
64 0.11
65 0.13
66 0.16
67 0.19
68 0.2
69 0.25
70 0.26
71 0.28
72 0.34
73 0.33
74 0.31
75 0.36
76 0.39
77 0.37
78 0.43
79 0.43
80 0.44
81 0.53
82 0.59
83 0.6
84 0.64
85 0.64
86 0.62
87 0.62
88 0.57
89 0.58
90 0.55
91 0.51
92 0.45
93 0.42
94 0.38
95 0.4
96 0.4
97 0.38
98 0.37
99 0.4
100 0.43
101 0.44
102 0.45
103 0.44
104 0.42
105 0.35
106 0.36
107 0.35
108 0.29
109 0.26
110 0.24
111 0.19
112 0.15
113 0.14
114 0.1
115 0.06
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.04
123 0.05
124 0.05
125 0.07
126 0.07
127 0.09
128 0.12
129 0.13
130 0.14
131 0.16
132 0.18
133 0.19
134 0.26
135 0.34
136 0.4
137 0.49
138 0.57
139 0.66
140 0.75
141 0.83
142 0.86
143 0.87
144 0.88
145 0.89
146 0.86
147 0.81
148 0.72
149 0.63
150 0.54
151 0.43
152 0.33
153 0.22
154 0.15
155 0.09
156 0.06
157 0.06
158 0.05
159 0.06
160 0.1
161 0.12
162 0.17
163 0.19
164 0.19
165 0.2
166 0.21
167 0.23
168 0.24
169 0.23
170 0.18
171 0.17
172 0.18
173 0.17
174 0.16
175 0.14
176 0.09
177 0.1
178 0.1
179 0.13
180 0.14
181 0.14
182 0.22
183 0.28
184 0.36
185 0.44
186 0.51
187 0.57
188 0.61
189 0.66
190 0.67
191 0.64
192 0.64
193 0.58
194 0.53
195 0.45
196 0.39
197 0.35
198 0.26
199 0.26
200 0.2
201 0.15
202 0.13
203 0.13
204 0.13
205 0.15
206 0.21
207 0.23
208 0.31
209 0.35
210 0.37
211 0.37
212 0.39
213 0.43
214 0.46
215 0.49
216 0.47
217 0.44
218 0.43
219 0.44
220 0.43
221 0.38
222 0.33
223 0.31
224 0.27
225 0.3
226 0.36
227 0.36
228 0.39
229 0.44
230 0.48
231 0.51
232 0.58
233 0.63