Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IZP0

Protein Details
Accession A0A395IZP0    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-68GLVGRGSKRRGSKRKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKKEKKDPNLLSCTFBasic
NLS Segment(s)
PositionSequence
12-59GRGSKRRGSKRKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKKEKK
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
Amino Acid Sequences MTVRLALKGLVGRGSKRRGSKRKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKKEKKDPNLLSCTFIVLSIDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.47
4 0.56
5 0.6
6 0.68
7 0.74
8 0.78
9 0.84
10 0.88
11 0.9
12 0.89
13 0.9
14 0.91
15 0.9
16 0.88
17 0.85
18 0.84
19 0.82
20 0.81
21 0.78
22 0.78
23 0.76
24 0.76
25 0.76
26 0.76
27 0.76
28 0.76
29 0.76
30 0.76
31 0.76
32 0.76
33 0.76
34 0.76
35 0.76
36 0.76
37 0.78
38 0.79
39 0.79
40 0.81
41 0.83
42 0.84
43 0.86
44 0.87
45 0.85
46 0.86
47 0.85
48 0.82
49 0.81
50 0.71
51 0.64
52 0.54
53 0.48
54 0.37
55 0.3