Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J7E3

Protein Details
Accession A0A395J7E3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
246-267GHDDHRTRRHMWKYGRRFRGGKBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002051  Haem_Oase  
IPR016053  Haem_Oase-like  
IPR016084  Haem_Oase-like_multi-hlx  
Gene Ontology GO:0004392  F:heme oxygenase (decyclizing) activity  
GO:0006788  P:heme oxidation  
Pfam View protein in Pfam  
PF01126  Heme_oxygenase  
CDD cd19165  HemeO  
Amino Acid Sequences MAESNITTHSNSPLPTPHQINIPYRIKLTLQQELSDSLDSQSSKVCPRTQSLLSHLLLPGLLRSERLQADIRTLTGTPDHRIEEQLKTVSENGRLAEFIAHTKQSVQTNPHVLLAYAWVLYMALFSGGRYLRAALKTAGGSEDFWDRDASPVRPYEATRAPKPTESPSKGLSEEEIRPSARRQTRSESSQTMKKDGLQFFDFVGDEDGEDIKREFKRRIAETEVQLTDSEKADIIKEAQAIFSFYGHDDHRTRRHMWKYGRRFRGGKIHTVHQTPPEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.38
4 0.36
5 0.4
6 0.45
7 0.48
8 0.51
9 0.52
10 0.47
11 0.44
12 0.45
13 0.39
14 0.4
15 0.41
16 0.4
17 0.35
18 0.34
19 0.34
20 0.34
21 0.35
22 0.29
23 0.24
24 0.16
25 0.18
26 0.17
27 0.16
28 0.17
29 0.17
30 0.22
31 0.26
32 0.29
33 0.29
34 0.33
35 0.39
36 0.4
37 0.41
38 0.42
39 0.44
40 0.4
41 0.39
42 0.34
43 0.28
44 0.24
45 0.2
46 0.15
47 0.11
48 0.1
49 0.09
50 0.11
51 0.15
52 0.16
53 0.19
54 0.22
55 0.2
56 0.24
57 0.24
58 0.23
59 0.2
60 0.2
61 0.17
62 0.18
63 0.19
64 0.17
65 0.19
66 0.21
67 0.2
68 0.23
69 0.25
70 0.23
71 0.25
72 0.24
73 0.22
74 0.21
75 0.23
76 0.22
77 0.22
78 0.2
79 0.17
80 0.16
81 0.15
82 0.14
83 0.13
84 0.11
85 0.11
86 0.12
87 0.11
88 0.11
89 0.12
90 0.15
91 0.17
92 0.2
93 0.21
94 0.23
95 0.27
96 0.27
97 0.28
98 0.24
99 0.21
100 0.18
101 0.15
102 0.12
103 0.08
104 0.07
105 0.05
106 0.05
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.06
114 0.06
115 0.07
116 0.07
117 0.08
118 0.11
119 0.11
120 0.13
121 0.1
122 0.12
123 0.11
124 0.11
125 0.11
126 0.09
127 0.08
128 0.08
129 0.1
130 0.09
131 0.09
132 0.1
133 0.09
134 0.11
135 0.14
136 0.14
137 0.14
138 0.15
139 0.15
140 0.16
141 0.17
142 0.2
143 0.25
144 0.29
145 0.29
146 0.34
147 0.34
148 0.34
149 0.36
150 0.38
151 0.4
152 0.38
153 0.38
154 0.36
155 0.37
156 0.36
157 0.34
158 0.29
159 0.23
160 0.22
161 0.22
162 0.22
163 0.2
164 0.2
165 0.22
166 0.29
167 0.31
168 0.34
169 0.35
170 0.41
171 0.47
172 0.52
173 0.55
174 0.52
175 0.5
176 0.51
177 0.49
178 0.44
179 0.38
180 0.37
181 0.39
182 0.35
183 0.35
184 0.31
185 0.29
186 0.26
187 0.27
188 0.23
189 0.16
190 0.16
191 0.1
192 0.09
193 0.09
194 0.1
195 0.08
196 0.09
197 0.09
198 0.12
199 0.17
200 0.21
201 0.23
202 0.28
203 0.36
204 0.39
205 0.45
206 0.48
207 0.5
208 0.5
209 0.55
210 0.5
211 0.43
212 0.39
213 0.34
214 0.28
215 0.22
216 0.19
217 0.12
218 0.12
219 0.12
220 0.13
221 0.14
222 0.14
223 0.15
224 0.15
225 0.15
226 0.15
227 0.16
228 0.15
229 0.13
230 0.12
231 0.11
232 0.14
233 0.14
234 0.2
235 0.22
236 0.29
237 0.37
238 0.41
239 0.45
240 0.51
241 0.59
242 0.63
243 0.7
244 0.73
245 0.77
246 0.82
247 0.86
248 0.85
249 0.79
250 0.77
251 0.77
252 0.7
253 0.68
254 0.63
255 0.62
256 0.61
257 0.62
258 0.58