Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IT22

Protein Details
Accession A0A395IT22    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-34IKLPTPRKVCDNCRRRRIRCDGKFPCKQCHydrophilic
NLS Segment(s)
PositionSequence
46-56VPKRRGPKKGS
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MPPEDIKLPTPRKVCDNCRRRRIRCDGKFPCKQCGNTSLTCKREHVPKRRGPKKGSGRVINELRAQDGGNSIKSFVESRGSGSGGSKYRPRLSQYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.69
4 0.72
5 0.78
6 0.86
7 0.83
8 0.84
9 0.85
10 0.86
11 0.84
12 0.85
13 0.85
14 0.84
15 0.86
16 0.79
17 0.77
18 0.71
19 0.64
20 0.56
21 0.52
22 0.48
23 0.44
24 0.49
25 0.48
26 0.45
27 0.44
28 0.43
29 0.38
30 0.43
31 0.47
32 0.49
33 0.51
34 0.56
35 0.65
36 0.72
37 0.76
38 0.71
39 0.72
40 0.73
41 0.73
42 0.73
43 0.69
44 0.65
45 0.66
46 0.65
47 0.58
48 0.5
49 0.41
50 0.34
51 0.28
52 0.24
53 0.16
54 0.17
55 0.16
56 0.14
57 0.14
58 0.14
59 0.13
60 0.15
61 0.15
62 0.13
63 0.16
64 0.14
65 0.17
66 0.18
67 0.19
68 0.18
69 0.19
70 0.24
71 0.22
72 0.26
73 0.29
74 0.33
75 0.39
76 0.43