Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395INL8

Protein Details
Accession A0A395INL8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-79AKQFHRILKRRVARQRLEKHFDBasic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001289  NFYA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF02045  CBFB_NFYA  
PROSITE View protein in PROSITE  
PS51152  NFYA_HAP2_2  
Amino Acid Sequences MSTQQVASPAVPSAQPLMKPCASVIGIRTFHVSTSSTTSQSPELVSGAVEESPLYVNAKQFHRILKRRVARQRLEKHFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.24
5 0.23
6 0.24
7 0.23
8 0.23
9 0.21
10 0.2
11 0.2
12 0.22
13 0.22
14 0.22
15 0.24
16 0.2
17 0.19
18 0.19
19 0.18
20 0.12
21 0.17
22 0.18
23 0.17
24 0.17
25 0.18
26 0.17
27 0.17
28 0.15
29 0.1
30 0.08
31 0.07
32 0.07
33 0.06
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.06
41 0.08
42 0.08
43 0.11
44 0.16
45 0.19
46 0.23
47 0.24
48 0.32
49 0.4
50 0.47
51 0.51
52 0.57
53 0.63
54 0.7
55 0.78
56 0.79
57 0.79
58 0.82
59 0.86