Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IQX0

Protein Details
Accession A0A395IQX0    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSRPQERTSYQPPPRRKQYSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 13.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR001806  Small_GTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00071  Ras  
Amino Acid Sequences MSRPQERTSYQPPPRRKQYSILFLGNAGTGKASMRNRIIYNEMQQHMTYDPTLEDSHRKSMTIDSEECIVDIMETDSAQAAQGFEEMCGNNDHGNLIYPYSSNMQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.76
4 0.74
5 0.74
6 0.74
7 0.71
8 0.64
9 0.54
10 0.46
11 0.43
12 0.35
13 0.25
14 0.16
15 0.09
16 0.07
17 0.07
18 0.13
19 0.14
20 0.17
21 0.2
22 0.24
23 0.25
24 0.27
25 0.31
26 0.27
27 0.31
28 0.32
29 0.31
30 0.28
31 0.27
32 0.26
33 0.22
34 0.2
35 0.15
36 0.09
37 0.08
38 0.09
39 0.09
40 0.09
41 0.12
42 0.13
43 0.18
44 0.18
45 0.18
46 0.17
47 0.19
48 0.22
49 0.23
50 0.22
51 0.18
52 0.19
53 0.19
54 0.18
55 0.16
56 0.11
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.08
73 0.08
74 0.09
75 0.11
76 0.12
77 0.12
78 0.12
79 0.13
80 0.11
81 0.13
82 0.13
83 0.12
84 0.12
85 0.11
86 0.14