Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IYP3

Protein Details
Accession A0A395IYP3    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
23-46QEVIETRKKRTKGKRVKLQGQFVFHydrophilic
56-80REAEEKPKEKKPRGRPRKRPIEELEBasic
NLS Segment(s)
PositionSequence
29-38RKKRTKGKRV
60-75EKPKEKKPRGRPRKRP
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MTRLVESQNAEIALLRKQLADAQEVIETRKKRTKGKRVKLQGQFVFSSEEVLKMVREAEEKPKEKKPRGRPRKRPIEELEEETEEEEPDSSSSDLELELDECVARRTRSHREN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.13
4 0.14
5 0.17
6 0.16
7 0.18
8 0.15
9 0.15
10 0.17
11 0.17
12 0.2
13 0.23
14 0.23
15 0.26
16 0.32
17 0.36
18 0.42
19 0.53
20 0.62
21 0.67
22 0.76
23 0.81
24 0.84
25 0.89
26 0.88
27 0.86
28 0.78
29 0.71
30 0.6
31 0.5
32 0.43
33 0.33
34 0.27
35 0.18
36 0.15
37 0.11
38 0.11
39 0.1
40 0.07
41 0.07
42 0.06
43 0.07
44 0.08
45 0.17
46 0.25
47 0.28
48 0.33
49 0.4
50 0.48
51 0.55
52 0.63
53 0.66
54 0.69
55 0.77
56 0.84
57 0.87
58 0.9
59 0.93
60 0.88
61 0.85
62 0.8
63 0.77
64 0.7
65 0.64
66 0.57
67 0.47
68 0.42
69 0.34
70 0.29
71 0.2
72 0.16
73 0.11
74 0.08
75 0.07
76 0.08
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.09
90 0.13
91 0.13
92 0.18
93 0.25