Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J245

Protein Details
Accession A0A395J245   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-70SPMPRNKFRNHNKSNSQHSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 15, cyto 10
Family & Domain DBs
Amino Acid Sequences MVKNFVFNDKSMENDFDFDSASSSPSPFAVAMDMESPQMPTIKHDTPRKISPMPRNKFRNHNKSNSQHSVAHSTNGFHMGSREASPYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.18
4 0.18
5 0.14
6 0.13
7 0.1
8 0.11
9 0.1
10 0.1
11 0.1
12 0.09
13 0.1
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.07
22 0.07
23 0.07
24 0.06
25 0.08
26 0.07
27 0.09
28 0.14
29 0.17
30 0.23
31 0.29
32 0.33
33 0.37
34 0.41
35 0.43
36 0.43
37 0.47
38 0.51
39 0.56
40 0.58
41 0.63
42 0.66
43 0.66
44 0.72
45 0.75
46 0.76
47 0.73
48 0.75
49 0.75
50 0.76
51 0.81
52 0.77
53 0.71
54 0.63
55 0.59
56 0.57
57 0.48
58 0.44
59 0.35
60 0.3
61 0.27
62 0.26
63 0.23
64 0.15
65 0.16
66 0.15
67 0.17
68 0.17