Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J198

Protein Details
Accession A0A395J198    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-47RLICKLPTRTWRKRLKGIAYRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8, cysk 7, cyto 6.5, cyto_pero 5.5, pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001870  B30.2/SPRY  
IPR043136  B30.2/SPRY_sf  
IPR013320  ConA-like_dom_sf  
IPR003877  SPRY_dom  
Gene Ontology GO:0010008  C:endosome membrane  
GO:0005774  C:vacuolar membrane  
Pfam View protein in Pfam  
PF00622  SPRY  
PROSITE View protein in PROSITE  
PS50188  B302_SPRY  
Amino Acid Sequences MLDKLCFDAGVLQTALDVAVQRGNERLICKLPTRTWRKRLKGIAYRIVLRTLHQFEQIVPSHRSEIFTFEITIINDGRENSGMIALGFGYKSADLNCRPGLDSFSWGYDGEDGGMFPRQAGYDDYDTYDKDDIIGCYADPMRRVAHFTRNGKRLGVHLSGQASLYELELH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.08
4 0.08
5 0.05
6 0.08
7 0.08
8 0.09
9 0.11
10 0.13
11 0.15
12 0.16
13 0.19
14 0.21
15 0.24
16 0.27
17 0.32
18 0.36
19 0.44
20 0.53
21 0.59
22 0.65
23 0.72
24 0.76
25 0.79
26 0.81
27 0.81
28 0.8
29 0.78
30 0.77
31 0.7
32 0.66
33 0.58
34 0.53
35 0.42
36 0.34
37 0.33
38 0.29
39 0.26
40 0.24
41 0.24
42 0.21
43 0.27
44 0.28
45 0.26
46 0.23
47 0.23
48 0.24
49 0.24
50 0.25
51 0.2
52 0.21
53 0.18
54 0.17
55 0.17
56 0.15
57 0.16
58 0.13
59 0.14
60 0.11
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.05
80 0.09
81 0.09
82 0.13
83 0.14
84 0.14
85 0.15
86 0.15
87 0.18
88 0.15
89 0.17
90 0.14
91 0.14
92 0.14
93 0.13
94 0.13
95 0.11
96 0.1
97 0.08
98 0.07
99 0.06
100 0.06
101 0.07
102 0.07
103 0.06
104 0.07
105 0.07
106 0.08
107 0.1
108 0.13
109 0.14
110 0.15
111 0.18
112 0.18
113 0.18
114 0.19
115 0.18
116 0.14
117 0.12
118 0.13
119 0.11
120 0.12
121 0.12
122 0.1
123 0.12
124 0.14
125 0.15
126 0.15
127 0.16
128 0.16
129 0.17
130 0.23
131 0.24
132 0.31
133 0.39
134 0.47
135 0.54
136 0.57
137 0.58
138 0.55
139 0.52
140 0.46
141 0.44
142 0.39
143 0.31
144 0.31
145 0.31
146 0.3
147 0.29
148 0.25
149 0.2
150 0.16