Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LG66

Protein Details
Accession E2LG66    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-43IKNKIKREEIANKNKKAKRQDKLQRRLERAKLEBasic
NLS Segment(s)
PositionSequence
13-53NKIKREEIANKNKKAKRQDKLQRRLERAKLEASDPATKKKR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR044281  IMP4/RPF1  
Gene Ontology GO:0042134  F:rRNA primary transcript binding  
GO:0006364  P:rRNA processing  
KEGG mpr:MPER_05423  -  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MPTSRFEPSVIKNKIKREEIANKNKKAKRQDKLQRRLERAKLEASDPATKKKRLTTNVPRTLDNTREFDPSFLTADPSSSTSARPEASSSGENDPQAQDETAADLANDPFAYYFASEEDPNIPPKVLITTSPKASKSTYDFCDELVGVFPGAEFIRRKKGKGFEMAPIAGLGPWGKATNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.63
4 0.62
5 0.66
6 0.68
7 0.73
8 0.74
9 0.74
10 0.8
11 0.8
12 0.78
13 0.79
14 0.78
15 0.75
16 0.77
17 0.79
18 0.8
19 0.87
20 0.89
21 0.88
22 0.86
23 0.87
24 0.83
25 0.79
26 0.71
27 0.66
28 0.57
29 0.49
30 0.44
31 0.39
32 0.4
33 0.35
34 0.41
35 0.41
36 0.42
37 0.43
38 0.47
39 0.51
40 0.49
41 0.58
42 0.6
43 0.65
44 0.72
45 0.72
46 0.65
47 0.6
48 0.58
49 0.53
50 0.45
51 0.37
52 0.29
53 0.3
54 0.3
55 0.27
56 0.24
57 0.2
58 0.18
59 0.14
60 0.14
61 0.11
62 0.11
63 0.11
64 0.11
65 0.12
66 0.11
67 0.11
68 0.1
69 0.12
70 0.12
71 0.12
72 0.11
73 0.1
74 0.12
75 0.13
76 0.14
77 0.15
78 0.16
79 0.16
80 0.16
81 0.14
82 0.13
83 0.13
84 0.1
85 0.08
86 0.06
87 0.08
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.05
95 0.04
96 0.04
97 0.04
98 0.05
99 0.04
100 0.05
101 0.06
102 0.08
103 0.08
104 0.08
105 0.11
106 0.12
107 0.14
108 0.15
109 0.13
110 0.12
111 0.12
112 0.14
113 0.12
114 0.14
115 0.19
116 0.22
117 0.27
118 0.32
119 0.32
120 0.32
121 0.32
122 0.34
123 0.32
124 0.35
125 0.33
126 0.34
127 0.33
128 0.32
129 0.33
130 0.28
131 0.22
132 0.17
133 0.14
134 0.09
135 0.09
136 0.08
137 0.08
138 0.08
139 0.11
140 0.13
141 0.16
142 0.27
143 0.3
144 0.32
145 0.38
146 0.47
147 0.5
148 0.57
149 0.56
150 0.53
151 0.57
152 0.56
153 0.48
154 0.4
155 0.33
156 0.23
157 0.21
158 0.14
159 0.08
160 0.09