Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395J0T8

Protein Details
Accession A0A395J0T8    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-32DDSTSRPTTKKPRHGFKVGPDNLHydrophilic
132-151EDSKGKKRERSEKRGAKPAYBasic
172-194EFERKEREKKAKIEERERFRRQMBasic
NLS Segment(s)
PositionSequence
38-66RRKVIAIKKDLIHKAKVKKSYAKLRAREP
135-210KGKKRERSEKRGAKPAYFVKELAFAEKQKAEQKARREEFERKEREKKAKIEERERFRRQMAKARSGGKNGQRKLGR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAPTKRPREDDSTSRPTTKKPRHGFKVGPDNLPDGTWRRKVIAIKKDLIHKAKVKKSYAKLRAREPLKAERNLYAEDEEKEKEDEEEVEKGEEREETGEEAVELHPQRKAMLDEPEVDTAAKTVPRYSNNSEDSKGKKRERSEKRGAKPAYFVKELAFAEKQKAEQKARREEFERKEREKKAKIEERERFRRQMAKARSGGKNGQRKLGRESHVLLEKVKRFVGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.61
3 0.62
4 0.65
5 0.66
6 0.68
7 0.69
8 0.75
9 0.77
10 0.85
11 0.82
12 0.81
13 0.82
14 0.76
15 0.7
16 0.61
17 0.54
18 0.46
19 0.4
20 0.33
21 0.27
22 0.29
23 0.3
24 0.29
25 0.29
26 0.33
27 0.4
28 0.47
29 0.51
30 0.51
31 0.52
32 0.54
33 0.6
34 0.63
35 0.6
36 0.57
37 0.55
38 0.58
39 0.6
40 0.64
41 0.62
42 0.63
43 0.67
44 0.71
45 0.74
46 0.74
47 0.72
48 0.71
49 0.74
50 0.68
51 0.65
52 0.6
53 0.6
54 0.58
55 0.57
56 0.52
57 0.46
58 0.46
59 0.42
60 0.38
61 0.29
62 0.24
63 0.21
64 0.21
65 0.18
66 0.17
67 0.16
68 0.15
69 0.13
70 0.12
71 0.12
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.11
79 0.1
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.07
86 0.06
87 0.07
88 0.07
89 0.09
90 0.09
91 0.09
92 0.1
93 0.1
94 0.11
95 0.11
96 0.13
97 0.12
98 0.16
99 0.16
100 0.18
101 0.19
102 0.2
103 0.18
104 0.16
105 0.13
106 0.09
107 0.09
108 0.08
109 0.07
110 0.09
111 0.12
112 0.15
113 0.21
114 0.24
115 0.31
116 0.34
117 0.36
118 0.35
119 0.37
120 0.4
121 0.44
122 0.49
123 0.47
124 0.49
125 0.54
126 0.63
127 0.69
128 0.72
129 0.74
130 0.76
131 0.76
132 0.8
133 0.75
134 0.66
135 0.62
136 0.58
137 0.53
138 0.45
139 0.39
140 0.29
141 0.33
142 0.31
143 0.29
144 0.25
145 0.2
146 0.22
147 0.23
148 0.25
149 0.26
150 0.33
151 0.36
152 0.4
153 0.48
154 0.55
155 0.57
156 0.6
157 0.6
158 0.62
159 0.63
160 0.68
161 0.69
162 0.65
163 0.71
164 0.74
165 0.79
166 0.77
167 0.76
168 0.76
169 0.76
170 0.78
171 0.8
172 0.8
173 0.81
174 0.83
175 0.82
176 0.76
177 0.72
178 0.7
179 0.66
180 0.67
181 0.66
182 0.64
183 0.65
184 0.68
185 0.67
186 0.65
187 0.67
188 0.66
189 0.67
190 0.6
191 0.63
192 0.61
193 0.59
194 0.61
195 0.61
196 0.56
197 0.52
198 0.53
199 0.51
200 0.53
201 0.51
202 0.48
203 0.48
204 0.48
205 0.47