Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395INU5

Protein Details
Accession A0A395INU5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
141-171LQKSTRKSHFTNKKSPEKKRQIFPSNSKSLRHydrophilic
NLS Segment(s)
PositionSequence
158-159KK
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039384  HINT  
IPR001310  Histidine_triad_HIT  
IPR011146  HIT-like  
IPR036265  HIT-like_sf  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF01230  HIT  
PROSITE View protein in PROSITE  
PS51084  HIT_2  
CDD cd01277  HINT_subgroup  
Amino Acid Sequences MASQAACIFCKIIKGDIPSFKLYESEKVLAFLDINPLSRGHALVIPKFHGEKLVDIPDDQLQEILPVVKKLVVASGAENYNVLQNNGRIAHQEVDHIPKPSTEEGLVIGWPQQKNRHGKTKSTIRRNKSQDVNSQSAIHTLQKSTRKSHFTNKKSPEKKRQIFPSNSKSLRVKLTRSKSTLTESAVGSLTHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.39
4 0.43
5 0.41
6 0.4
7 0.37
8 0.36
9 0.32
10 0.31
11 0.29
12 0.27
13 0.25
14 0.25
15 0.26
16 0.23
17 0.21
18 0.16
19 0.17
20 0.16
21 0.17
22 0.16
23 0.16
24 0.17
25 0.17
26 0.17
27 0.12
28 0.14
29 0.16
30 0.17
31 0.2
32 0.2
33 0.21
34 0.22
35 0.2
36 0.21
37 0.19
38 0.19
39 0.21
40 0.23
41 0.22
42 0.21
43 0.22
44 0.21
45 0.21
46 0.18
47 0.14
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.09
59 0.08
60 0.08
61 0.08
62 0.11
63 0.1
64 0.1
65 0.1
66 0.09
67 0.11
68 0.11
69 0.1
70 0.09
71 0.09
72 0.11
73 0.12
74 0.12
75 0.1
76 0.12
77 0.13
78 0.12
79 0.13
80 0.12
81 0.17
82 0.19
83 0.19
84 0.17
85 0.16
86 0.18
87 0.17
88 0.17
89 0.11
90 0.1
91 0.1
92 0.1
93 0.1
94 0.07
95 0.09
96 0.12
97 0.13
98 0.15
99 0.19
100 0.25
101 0.34
102 0.39
103 0.47
104 0.46
105 0.5
106 0.56
107 0.62
108 0.65
109 0.68
110 0.71
111 0.66
112 0.73
113 0.75
114 0.75
115 0.72
116 0.69
117 0.66
118 0.65
119 0.63
120 0.55
121 0.5
122 0.42
123 0.35
124 0.31
125 0.25
126 0.2
127 0.17
128 0.22
129 0.28
130 0.32
131 0.36
132 0.42
133 0.45
134 0.48
135 0.58
136 0.62
137 0.63
138 0.7
139 0.73
140 0.77
141 0.8
142 0.86
143 0.86
144 0.87
145 0.87
146 0.86
147 0.87
148 0.86
149 0.86
150 0.86
151 0.84
152 0.83
153 0.76
154 0.73
155 0.66
156 0.61
157 0.61
158 0.56
159 0.55
160 0.55
161 0.63
162 0.65
163 0.65
164 0.65
165 0.59
166 0.6
167 0.57
168 0.51
169 0.45
170 0.37
171 0.35
172 0.32