Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395ILN1

Protein Details
Accession A0A395ILN1   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
66-85NRATSRSKYGTKKPKKAAAAHydrophilic
NLS Segment(s)
PositionSequence
73-83KYGTKKPKKAA
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MRKSVSPALSTVQAPALKGVALKVGITKPKKPNSGRTEKRQEQESRLSGVRYHLVRGAGDLGGVGNRATSRSKYGTKKPKKAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.16
4 0.13
5 0.13
6 0.12
7 0.09
8 0.09
9 0.08
10 0.1
11 0.14
12 0.21
13 0.24
14 0.32
15 0.38
16 0.45
17 0.54
18 0.55
19 0.62
20 0.64
21 0.71
22 0.71
23 0.72
24 0.75
25 0.72
26 0.71
27 0.69
28 0.63
29 0.56
30 0.56
31 0.48
32 0.41
33 0.36
34 0.33
35 0.26
36 0.25
37 0.25
38 0.18
39 0.18
40 0.17
41 0.17
42 0.16
43 0.16
44 0.16
45 0.11
46 0.1
47 0.09
48 0.07
49 0.06
50 0.07
51 0.05
52 0.05
53 0.05
54 0.07
55 0.1
56 0.12
57 0.17
58 0.23
59 0.31
60 0.39
61 0.49
62 0.59
63 0.67
64 0.76
65 0.8