Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J3M0

Protein Details
Accession A0A395J3M0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
5-24NSSLHSSRRKSRKAHFDAPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MTKINSSLHSSRRKSRKAHFDAPSSVRRTIMSAPLSKELREKYNVRSIPIRKDDEVTIVRGSNKGSEGKVTSVYRLKYVIHIERVVKEKSSGQSVPLGIHPSKVIITPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.78
4 0.77
5 0.81
6 0.78
7 0.74
8 0.73
9 0.71
10 0.68
11 0.61
12 0.53
13 0.44
14 0.38
15 0.34
16 0.29
17 0.3
18 0.27
19 0.26
20 0.28
21 0.33
22 0.34
23 0.31
24 0.33
25 0.29
26 0.29
27 0.31
28 0.31
29 0.3
30 0.38
31 0.39
32 0.37
33 0.42
34 0.41
35 0.44
36 0.47
37 0.45
38 0.37
39 0.37
40 0.35
41 0.32
42 0.3
43 0.24
44 0.19
45 0.16
46 0.16
47 0.15
48 0.15
49 0.12
50 0.12
51 0.12
52 0.12
53 0.13
54 0.14
55 0.15
56 0.2
57 0.19
58 0.21
59 0.23
60 0.24
61 0.23
62 0.23
63 0.22
64 0.21
65 0.27
66 0.29
67 0.28
68 0.31
69 0.32
70 0.35
71 0.39
72 0.37
73 0.31
74 0.28
75 0.29
76 0.28
77 0.33
78 0.29
79 0.26
80 0.29
81 0.29
82 0.29
83 0.27
84 0.29
85 0.22
86 0.23
87 0.22
88 0.19
89 0.19