Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395J0G7

Protein Details
Accession A0A395J0G7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-36ALSTKHLLHQRKTKKKENKTKDGDTAHydrophilic
NLS Segment(s)
PositionSequence
4-29KRPTRKLALSTKHLLHQRKTKKKENK
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MTKKRPTRKLALSTKHLLHQRKTKKKENKTKDGDTAMEDVVYKTDAEIDAEKAAAILDAKKELHALINPDLAKDDGANKSGLYELRGICHSSRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.67
3 0.65
4 0.6
5 0.57
6 0.59
7 0.63
8 0.67
9 0.73
10 0.77
11 0.8
12 0.85
13 0.89
14 0.89
15 0.88
16 0.86
17 0.84
18 0.79
19 0.72
20 0.62
21 0.52
22 0.44
23 0.33
24 0.25
25 0.19
26 0.13
27 0.1
28 0.09
29 0.07
30 0.04
31 0.05
32 0.05
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.05
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.1
51 0.11
52 0.14
53 0.15
54 0.19
55 0.19
56 0.19
57 0.2
58 0.18
59 0.17
60 0.13
61 0.16
62 0.14
63 0.15
64 0.16
65 0.14
66 0.15
67 0.17
68 0.17
69 0.14
70 0.17
71 0.16
72 0.19
73 0.21
74 0.23