Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IU41

Protein Details
Accession A0A395IU41    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-62EAAAKKENKKKERIRRNMDTIIHHydrophilic
NLS Segment(s)
PositionSequence
44-54KKENKKKERIR
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
Amino Acid Sequences MAKRLERAQALAISGEIYSKAQRNAEEEGDYMAFEQLVAEAAAKKENKKKERIRRNMDTIIHHSHSEAQAAADDLPNVPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.09
4 0.08
5 0.1
6 0.13
7 0.15
8 0.17
9 0.18
10 0.21
11 0.24
12 0.25
13 0.23
14 0.2
15 0.19
16 0.17
17 0.16
18 0.13
19 0.09
20 0.07
21 0.05
22 0.05
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.09
30 0.1
31 0.14
32 0.2
33 0.3
34 0.35
35 0.45
36 0.55
37 0.62
38 0.72
39 0.79
40 0.82
41 0.81
42 0.83
43 0.81
44 0.74
45 0.69
46 0.64
47 0.6
48 0.52
49 0.44
50 0.37
51 0.34
52 0.31
53 0.26
54 0.21
55 0.14
56 0.13
57 0.14
58 0.14
59 0.11
60 0.1
61 0.1