Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IVB2

Protein Details
Accession A0A395IVB2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
247-276FPQGRRSKTGKRKSTVRTRSKAKREKEDEEBasic
NLS Segment(s)
PositionSequence
209-272KAAGIPRRTWRIRPHGNRERAARSRIRRPGSGLEVVPPFPQGRRSKTGKRKSTVRTRSKAKREK
Subcellular Location(s) mito 12.5, cyto_mito 11.5, cyto 9.5, pero 3
Family & Domain DBs
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MPEVAWKDDKMQRIGPPGRFVLKLYAVSKTASLTDEEGGVHTLATQDDINYYNGEYDDIPPGYYDYKDMPEAEKNMNRRRVEIENRARAKLSGTHGYTVMSYKTVQGIWQRKLAPSTTPYFPEPPVEDAKLPPPWNDLTKEQGGGLGRPVPEYLESHELGIDDLFHATTEYEKAAMVRLLFERHAVDSRAHEGSIFQGYAPGIAGGVPKAAGIPRRTWRIRPHGNRERAARSRIRRPGSGLEVVPPFPQGRRSKTGKRKSTVRTRSKAKREKEDEEEGFETGPYSPSGCKKSVDKALITCALEIPELQNSVLFCTVAERRFVKGIIYLVGLAPSTTVLQIKQMLTEKETGVPVEDIEVEWVMIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.55
4 0.53
5 0.52
6 0.48
7 0.45
8 0.41
9 0.37
10 0.39
11 0.35
12 0.34
13 0.31
14 0.31
15 0.3
16 0.25
17 0.22
18 0.17
19 0.17
20 0.16
21 0.15
22 0.15
23 0.14
24 0.14
25 0.13
26 0.12
27 0.1
28 0.08
29 0.09
30 0.08
31 0.09
32 0.09
33 0.08
34 0.09
35 0.11
36 0.12
37 0.12
38 0.12
39 0.12
40 0.12
41 0.13
42 0.12
43 0.12
44 0.16
45 0.16
46 0.16
47 0.15
48 0.16
49 0.17
50 0.16
51 0.16
52 0.13
53 0.16
54 0.18
55 0.19
56 0.2
57 0.24
58 0.27
59 0.33
60 0.35
61 0.41
62 0.48
63 0.55
64 0.53
65 0.5
66 0.52
67 0.53
68 0.57
69 0.6
70 0.61
71 0.62
72 0.65
73 0.64
74 0.6
75 0.51
76 0.45
77 0.4
78 0.35
79 0.33
80 0.31
81 0.31
82 0.3
83 0.3
84 0.28
85 0.24
86 0.19
87 0.12
88 0.11
89 0.1
90 0.12
91 0.11
92 0.14
93 0.21
94 0.28
95 0.3
96 0.35
97 0.36
98 0.36
99 0.38
100 0.36
101 0.31
102 0.27
103 0.29
104 0.26
105 0.27
106 0.28
107 0.28
108 0.27
109 0.27
110 0.25
111 0.24
112 0.25
113 0.24
114 0.23
115 0.22
116 0.25
117 0.27
118 0.26
119 0.23
120 0.22
121 0.23
122 0.25
123 0.27
124 0.24
125 0.24
126 0.25
127 0.24
128 0.21
129 0.21
130 0.19
131 0.16
132 0.15
133 0.13
134 0.12
135 0.12
136 0.12
137 0.1
138 0.11
139 0.11
140 0.13
141 0.14
142 0.14
143 0.13
144 0.14
145 0.13
146 0.12
147 0.11
148 0.08
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.07
163 0.06
164 0.07
165 0.08
166 0.09
167 0.09
168 0.1
169 0.1
170 0.1
171 0.11
172 0.11
173 0.11
174 0.11
175 0.15
176 0.14
177 0.13
178 0.12
179 0.11
180 0.11
181 0.12
182 0.1
183 0.07
184 0.08
185 0.07
186 0.08
187 0.07
188 0.06
189 0.04
190 0.04
191 0.05
192 0.04
193 0.04
194 0.04
195 0.03
196 0.04
197 0.05
198 0.09
199 0.11
200 0.16
201 0.21
202 0.3
203 0.32
204 0.37
205 0.44
206 0.5
207 0.59
208 0.63
209 0.69
210 0.71
211 0.76
212 0.76
213 0.73
214 0.71
215 0.66
216 0.63
217 0.6
218 0.56
219 0.59
220 0.62
221 0.61
222 0.54
223 0.54
224 0.54
225 0.5
226 0.48
227 0.38
228 0.34
229 0.31
230 0.3
231 0.26
232 0.21
233 0.17
234 0.14
235 0.22
236 0.24
237 0.29
238 0.35
239 0.43
240 0.52
241 0.62
242 0.72
243 0.73
244 0.74
245 0.77
246 0.79
247 0.82
248 0.83
249 0.82
250 0.8
251 0.81
252 0.85
253 0.87
254 0.86
255 0.83
256 0.83
257 0.81
258 0.79
259 0.76
260 0.75
261 0.66
262 0.62
263 0.55
264 0.45
265 0.37
266 0.3
267 0.23
268 0.15
269 0.14
270 0.09
271 0.09
272 0.11
273 0.17
274 0.22
275 0.23
276 0.26
277 0.28
278 0.36
279 0.43
280 0.45
281 0.42
282 0.4
283 0.44
284 0.46
285 0.42
286 0.35
287 0.27
288 0.23
289 0.2
290 0.19
291 0.15
292 0.12
293 0.12
294 0.12
295 0.12
296 0.12
297 0.14
298 0.14
299 0.12
300 0.1
301 0.13
302 0.19
303 0.19
304 0.24
305 0.23
306 0.25
307 0.28
308 0.28
309 0.25
310 0.24
311 0.24
312 0.2
313 0.2
314 0.18
315 0.15
316 0.16
317 0.14
318 0.1
319 0.09
320 0.08
321 0.07
322 0.08
323 0.09
324 0.09
325 0.12
326 0.17
327 0.18
328 0.22
329 0.27
330 0.28
331 0.3
332 0.33
333 0.31
334 0.3
335 0.31
336 0.26
337 0.23
338 0.21
339 0.18
340 0.16
341 0.16
342 0.12
343 0.13
344 0.13