Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J6Y3

Protein Details
Accession A0A395J6Y3   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
100-126FLSRIRTRKGRATLQRRKSKKRSTLSHHydrophilic
NLS Segment(s)
PositionSequence
94-122RKRRHGFLSRIRTRKGRATLQRRKSKKRS
Subcellular Location(s) mito 13.5, nucl 11, cyto_mito 8.166, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCLRCSHSLRATPIVSRVLFQSSSLLAKRTFTSITPLRPTLSPSAFKPTSSVVVSSEAAPLDLLPKISTHPALSTTQVRCGPRNTFSPSHFVRKRRHGFLSRIRTRKGRATLQRRKSKKRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.36
4 0.3
5 0.27
6 0.24
7 0.22
8 0.2
9 0.19
10 0.15
11 0.19
12 0.19
13 0.19
14 0.16
15 0.18
16 0.18
17 0.19
18 0.19
19 0.15
20 0.22
21 0.24
22 0.29
23 0.31
24 0.32
25 0.31
26 0.3
27 0.32
28 0.3
29 0.3
30 0.27
31 0.24
32 0.31
33 0.3
34 0.29
35 0.28
36 0.24
37 0.23
38 0.21
39 0.2
40 0.13
41 0.15
42 0.16
43 0.14
44 0.14
45 0.1
46 0.09
47 0.08
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.08
57 0.08
58 0.08
59 0.1
60 0.11
61 0.14
62 0.19
63 0.19
64 0.23
65 0.27
66 0.28
67 0.28
68 0.31
69 0.32
70 0.29
71 0.34
72 0.35
73 0.35
74 0.35
75 0.4
76 0.4
77 0.47
78 0.49
79 0.51
80 0.53
81 0.6
82 0.66
83 0.66
84 0.71
85 0.68
86 0.71
87 0.74
88 0.77
89 0.76
90 0.75
91 0.73
92 0.7
93 0.68
94 0.68
95 0.65
96 0.64
97 0.65
98 0.7
99 0.76
100 0.81
101 0.86
102 0.87
103 0.9
104 0.91
105 0.91
106 0.9