Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IP33

Protein Details
Accession A0A395IP33    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-72DDDPSVEKYSQKRRKQRFRGPWFDQQLAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MAEELSLPRLNRHNISSTPATPNLSRKRVRDTPPDSSDPPIFSSDDDPSVEKYSQKRRKQRFRGPWFDQQLASDSAIEDESLYRKVPIRNRRTFSKKVDSGVFMGSDGTDVDDAIMDNGKKAWPANNIVVPSPLKSRITLNIPKDIHAQRKIERCLENGEEYIDLSRLALDHLENSTIRPLGTFVKAARGYGTLEPSLRIILSGNHLSKLPAELFNLNRLVFLSLRDNKLKEIPPSIGKLKILEDLNISQNNLGYLPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.46
4 0.43
5 0.44
6 0.43
7 0.42
8 0.4
9 0.47
10 0.5
11 0.53
12 0.55
13 0.53
14 0.6
15 0.65
16 0.69
17 0.7
18 0.69
19 0.69
20 0.7
21 0.72
22 0.65
23 0.6
24 0.56
25 0.47
26 0.41
27 0.34
28 0.27
29 0.23
30 0.24
31 0.21
32 0.2
33 0.2
34 0.19
35 0.19
36 0.23
37 0.22
38 0.23
39 0.29
40 0.38
41 0.47
42 0.55
43 0.63
44 0.7
45 0.81
46 0.87
47 0.91
48 0.91
49 0.92
50 0.92
51 0.88
52 0.87
53 0.82
54 0.74
55 0.63
56 0.53
57 0.45
58 0.37
59 0.31
60 0.21
61 0.14
62 0.13
63 0.12
64 0.11
65 0.08
66 0.06
67 0.07
68 0.08
69 0.09
70 0.09
71 0.13
72 0.19
73 0.27
74 0.37
75 0.45
76 0.53
77 0.58
78 0.66
79 0.7
80 0.72
81 0.72
82 0.71
83 0.64
84 0.59
85 0.57
86 0.49
87 0.42
88 0.36
89 0.28
90 0.18
91 0.15
92 0.11
93 0.08
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.06
108 0.07
109 0.1
110 0.11
111 0.15
112 0.17
113 0.19
114 0.2
115 0.2
116 0.21
117 0.18
118 0.17
119 0.15
120 0.15
121 0.13
122 0.14
123 0.15
124 0.16
125 0.23
126 0.28
127 0.29
128 0.34
129 0.34
130 0.34
131 0.39
132 0.4
133 0.4
134 0.38
135 0.4
136 0.37
137 0.45
138 0.47
139 0.46
140 0.44
141 0.38
142 0.38
143 0.37
144 0.34
145 0.26
146 0.24
147 0.18
148 0.16
149 0.15
150 0.11
151 0.08
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.06
159 0.06
160 0.08
161 0.08
162 0.09
163 0.11
164 0.1
165 0.1
166 0.09
167 0.1
168 0.11
169 0.13
170 0.15
171 0.13
172 0.21
173 0.21
174 0.21
175 0.21
176 0.19
177 0.2
178 0.2
179 0.23
180 0.16
181 0.17
182 0.17
183 0.16
184 0.16
185 0.13
186 0.11
187 0.08
188 0.08
189 0.13
190 0.19
191 0.19
192 0.19
193 0.2
194 0.2
195 0.2
196 0.22
197 0.19
198 0.15
199 0.17
200 0.21
201 0.22
202 0.26
203 0.28
204 0.25
205 0.23
206 0.22
207 0.21
208 0.17
209 0.18
210 0.23
211 0.26
212 0.31
213 0.36
214 0.36
215 0.37
216 0.44
217 0.46
218 0.42
219 0.41
220 0.4
221 0.4
222 0.45
223 0.46
224 0.43
225 0.39
226 0.37
227 0.34
228 0.35
229 0.32
230 0.27
231 0.28
232 0.27
233 0.32
234 0.32
235 0.3
236 0.25
237 0.24
238 0.23