Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395J9H7

Protein Details
Accession A0A395J9H7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MGRELQKKKNRSGNSKIKLKPKSKRVNPLGNAHydrophilic
NLS Segment(s)
PositionSequence
7-25KKKNRSGNSKIKLKPKSKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MGRELQKKKNRSGNSKIKLKPKSKRVNPLGNAIIAANWRQDETLTQNYRRLGLTSRLNTVTGGIEKKQAGPESKTSTASKLAISNAIPKNLAPTEARVEKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.82
4 0.81
5 0.82
6 0.82
7 0.81
8 0.81
9 0.82
10 0.81
11 0.85
12 0.84
13 0.85
14 0.78
15 0.76
16 0.67
17 0.56
18 0.47
19 0.36
20 0.28
21 0.18
22 0.16
23 0.1
24 0.08
25 0.08
26 0.07
27 0.08
28 0.09
29 0.13
30 0.21
31 0.24
32 0.25
33 0.28
34 0.29
35 0.3
36 0.28
37 0.24
38 0.18
39 0.2
40 0.25
41 0.24
42 0.26
43 0.26
44 0.26
45 0.25
46 0.23
47 0.18
48 0.14
49 0.14
50 0.12
51 0.14
52 0.14
53 0.16
54 0.18
55 0.21
56 0.22
57 0.24
58 0.29
59 0.33
60 0.35
61 0.37
62 0.35
63 0.34
64 0.34
65 0.31
66 0.27
67 0.22
68 0.21
69 0.2
70 0.2
71 0.27
72 0.27
73 0.27
74 0.26
75 0.24
76 0.28
77 0.26
78 0.28
79 0.21
80 0.22
81 0.28
82 0.36