Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IS97

Protein Details
Accession A0A395IS97    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-37MMLAMRKKRKSKAHSKSTFDIHydrophilic
NLS Segment(s)
PositionSequence
4-30AKKAAGKGGKEKAMMLAMRKKRKSKAH
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046357  PPIase_dom_sf  
IPR000297  PPIase_PpiC  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
Pfam View protein in Pfam  
PF00639  Rotamase  
PROSITE View protein in PROSITE  
PS50198  PPIC_PPIASE_2  
Amino Acid Sequences MAPAKKAAGKGGKEKAMMLAMRKKRKSKAHSKSTFDIYFAPSIGVSEDKARAGGALGWKGKGDLDPEFEKVAFEMEASTTTKPKYRDVKTGFGYHIIMVEGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.39
4 0.36
5 0.33
6 0.35
7 0.39
8 0.48
9 0.54
10 0.59
11 0.62
12 0.71
13 0.75
14 0.76
15 0.78
16 0.8
17 0.82
18 0.82
19 0.77
20 0.75
21 0.66
22 0.55
23 0.46
24 0.37
25 0.29
26 0.22
27 0.18
28 0.1
29 0.1
30 0.09
31 0.08
32 0.06
33 0.07
34 0.08
35 0.07
36 0.08
37 0.07
38 0.07
39 0.06
40 0.07
41 0.08
42 0.11
43 0.12
44 0.12
45 0.12
46 0.12
47 0.12
48 0.12
49 0.12
50 0.09
51 0.14
52 0.15
53 0.17
54 0.18
55 0.17
56 0.16
57 0.14
58 0.14
59 0.09
60 0.07
61 0.06
62 0.06
63 0.08
64 0.1
65 0.11
66 0.12
67 0.14
68 0.18
69 0.2
70 0.28
71 0.36
72 0.39
73 0.49
74 0.52
75 0.6
76 0.6
77 0.63
78 0.56
79 0.5
80 0.45
81 0.35
82 0.3
83 0.22