Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J5W1

Protein Details
Accession A0A395J5W1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
307-331APGSAKKRGRPAKEGGRPAKRRKACBasic
NLS Segment(s)
PositionSequence
228-330RRRPNLPPSGRGRGRPASGIIKPNPAPKPAKEPKVATPKAEKAPKPPKIKAPAATVNTKSPGKRGRPAKVAVEDKNAAAAPGSAKKRGRPAKEGGRPAKRRKA
Subcellular Location(s) cyto 16, cyto_nucl 12.333, nucl 6.5, mito_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MSSPKDITLSEFSQTLARYPTILNKYSKDAKDGVTPLQELDKFRYVEAPARFKDGSNTFTTDDILKLVEWKLRHGAYRPGFLKKVAKNTDETVEAATKDAFSHYKAHPNEIDVVINKLKEPLMGIGPATASLILSVYDPEHVTFFSDEVFKWLVNDGEHKPTPKYSVVEFQKVHAAAKTLAARLRVNPLQIEKVAFVIIKESEPVFVPKERPAPVVVVAVVQLNPIVRRRPNLPPSGRGRGRPASGIIKPNPAPKPAKEPKVATPKAEKAPKPPKIKAPAATVNTKSPGKRGRPAKVAVEDKNAAAAPGSAKKRGRPAKEGGRPAKRRKAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.19
4 0.18
5 0.18
6 0.19
7 0.27
8 0.3
9 0.36
10 0.37
11 0.37
12 0.44
13 0.52
14 0.52
15 0.47
16 0.44
17 0.4
18 0.44
19 0.44
20 0.41
21 0.35
22 0.34
23 0.31
24 0.34
25 0.34
26 0.29
27 0.32
28 0.34
29 0.3
30 0.3
31 0.34
32 0.3
33 0.34
34 0.39
35 0.41
36 0.36
37 0.41
38 0.41
39 0.37
40 0.43
41 0.39
42 0.36
43 0.32
44 0.34
45 0.3
46 0.3
47 0.3
48 0.24
49 0.2
50 0.17
51 0.13
52 0.1
53 0.11
54 0.13
55 0.15
56 0.14
57 0.17
58 0.22
59 0.23
60 0.26
61 0.27
62 0.34
63 0.35
64 0.43
65 0.43
66 0.43
67 0.43
68 0.44
69 0.49
70 0.44
71 0.5
72 0.47
73 0.46
74 0.44
75 0.45
76 0.44
77 0.37
78 0.33
79 0.26
80 0.21
81 0.19
82 0.17
83 0.14
84 0.12
85 0.1
86 0.12
87 0.1
88 0.1
89 0.15
90 0.17
91 0.25
92 0.26
93 0.3
94 0.29
95 0.3
96 0.31
97 0.27
98 0.27
99 0.19
100 0.22
101 0.19
102 0.18
103 0.16
104 0.14
105 0.13
106 0.11
107 0.12
108 0.1
109 0.09
110 0.1
111 0.09
112 0.08
113 0.08
114 0.08
115 0.07
116 0.05
117 0.04
118 0.03
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.09
136 0.1
137 0.08
138 0.09
139 0.09
140 0.09
141 0.09
142 0.13
143 0.13
144 0.18
145 0.19
146 0.2
147 0.2
148 0.2
149 0.23
150 0.21
151 0.21
152 0.17
153 0.24
154 0.26
155 0.32
156 0.31
157 0.29
158 0.3
159 0.29
160 0.28
161 0.2
162 0.18
163 0.12
164 0.15
165 0.16
166 0.14
167 0.15
168 0.17
169 0.17
170 0.16
171 0.22
172 0.2
173 0.19
174 0.19
175 0.19
176 0.19
177 0.19
178 0.19
179 0.13
180 0.12
181 0.12
182 0.1
183 0.09
184 0.08
185 0.08
186 0.07
187 0.08
188 0.07
189 0.08
190 0.08
191 0.1
192 0.11
193 0.13
194 0.15
195 0.18
196 0.23
197 0.24
198 0.24
199 0.24
200 0.23
201 0.22
202 0.21
203 0.17
204 0.12
205 0.11
206 0.1
207 0.09
208 0.07
209 0.06
210 0.06
211 0.08
212 0.1
213 0.15
214 0.16
215 0.19
216 0.24
217 0.34
218 0.4
219 0.48
220 0.5
221 0.53
222 0.59
223 0.66
224 0.64
225 0.58
226 0.57
227 0.53
228 0.5
229 0.44
230 0.41
231 0.37
232 0.39
233 0.43
234 0.38
235 0.4
236 0.4
237 0.46
238 0.45
239 0.45
240 0.45
241 0.4
242 0.49
243 0.51
244 0.56
245 0.54
246 0.55
247 0.58
248 0.65
249 0.65
250 0.59
251 0.58
252 0.58
253 0.6
254 0.65
255 0.58
256 0.58
257 0.66
258 0.7
259 0.71
260 0.7
261 0.71
262 0.71
263 0.76
264 0.7
265 0.68
266 0.68
267 0.64
268 0.65
269 0.59
270 0.54
271 0.52
272 0.51
273 0.43
274 0.42
275 0.47
276 0.47
277 0.53
278 0.58
279 0.62
280 0.65
281 0.7
282 0.7
283 0.7
284 0.71
285 0.66
286 0.64
287 0.56
288 0.49
289 0.46
290 0.38
291 0.29
292 0.21
293 0.18
294 0.15
295 0.22
296 0.25
297 0.3
298 0.33
299 0.38
300 0.48
301 0.57
302 0.6
303 0.59
304 0.66
305 0.69
306 0.76
307 0.82
308 0.81
309 0.83
310 0.85
311 0.88