Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IWL6

Protein Details
Accession A0A395IWL6    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
68-90TDGGTRKAKPKRKTKEDEYDKDDBasic
134-153AKKVRIRKPKATGEKSPCRQBasic
NLS Segment(s)
PositionSequence
73-81RKAKPKRKT
132-145GPAKKVRIRKPKAT
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014840  HRD  
Pfam View protein in Pfam  
PF08729  HUN  
Amino Acid Sequences MAEEAYGWDALHPRLAAQRDRLARVAAAGAALERNGSSKESGDEMSLDSEGEGSNVEMGGMSDGRIGTDGGTRKAKPKRKTKEDEYDKDDGFVDDSEMLWEQQAAAANDGFFVYSGPLVREGEKPTLDRGEGPAKKVRIRKPKATGEKSPCRQSASSGSKAVGTSGGAGSRGGTTAPRKSRITKADRAVWIRRSLSESKWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.28
4 0.31
5 0.39
6 0.41
7 0.44
8 0.45
9 0.4
10 0.35
11 0.31
12 0.27
13 0.19
14 0.14
15 0.1
16 0.09
17 0.07
18 0.07
19 0.06
20 0.05
21 0.07
22 0.08
23 0.09
24 0.1
25 0.1
26 0.12
27 0.14
28 0.15
29 0.14
30 0.13
31 0.13
32 0.13
33 0.12
34 0.1
35 0.08
36 0.08
37 0.07
38 0.06
39 0.06
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.05
55 0.1
56 0.11
57 0.14
58 0.18
59 0.19
60 0.27
61 0.36
62 0.44
63 0.49
64 0.58
65 0.65
66 0.71
67 0.79
68 0.8
69 0.83
70 0.84
71 0.81
72 0.77
73 0.71
74 0.6
75 0.52
76 0.44
77 0.32
78 0.23
79 0.16
80 0.11
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.04
89 0.05
90 0.07
91 0.07
92 0.07
93 0.08
94 0.07
95 0.08
96 0.08
97 0.06
98 0.04
99 0.04
100 0.03
101 0.04
102 0.04
103 0.05
104 0.06
105 0.07
106 0.09
107 0.12
108 0.14
109 0.17
110 0.18
111 0.19
112 0.19
113 0.2
114 0.19
115 0.17
116 0.18
117 0.25
118 0.25
119 0.27
120 0.31
121 0.32
122 0.38
123 0.45
124 0.5
125 0.51
126 0.57
127 0.63
128 0.67
129 0.74
130 0.79
131 0.79
132 0.79
133 0.78
134 0.81
135 0.78
136 0.77
137 0.68
138 0.62
139 0.56
140 0.5
141 0.51
142 0.48
143 0.46
144 0.4
145 0.38
146 0.35
147 0.35
148 0.31
149 0.22
150 0.14
151 0.11
152 0.1
153 0.11
154 0.09
155 0.09
156 0.09
157 0.09
158 0.09
159 0.08
160 0.11
161 0.16
162 0.24
163 0.31
164 0.36
165 0.4
166 0.46
167 0.54
168 0.6
169 0.63
170 0.63
171 0.65
172 0.67
173 0.71
174 0.72
175 0.71
176 0.66
177 0.65
178 0.58
179 0.53
180 0.51
181 0.47