Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IJX8

Protein Details
Accession A0A395IJX8    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-85GGEEEGGRRRRRRRRDREKGREGKKERMRRREGSDLBasic
NLS Segment(s)
PositionSequence
24-41KPGAKFPASEKERKKEEE
54-81EGGRRRRRRRRDREKGREGKKERMRRRE
Subcellular Location(s) nucl 17, mito 10
Family & Domain DBs
Amino Acid Sequences MSTRIELHRKEGGRCIQFYIIEKKPGAKFPASEKERKKEEEGREEEEEEGGEEEGGRRRRRRRRDREKGREGKKERMRRREGSDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.41
4 0.4
5 0.41
6 0.41
7 0.35
8 0.35
9 0.34
10 0.36
11 0.36
12 0.38
13 0.37
14 0.31
15 0.3
16 0.33
17 0.43
18 0.41
19 0.47
20 0.47
21 0.51
22 0.54
23 0.55
24 0.53
25 0.51
26 0.54
27 0.55
28 0.54
29 0.51
30 0.48
31 0.46
32 0.4
33 0.32
34 0.25
35 0.16
36 0.12
37 0.07
38 0.05
39 0.04
40 0.06
41 0.12
42 0.18
43 0.23
44 0.3
45 0.4
46 0.51
47 0.62
48 0.72
49 0.78
50 0.83
51 0.89
52 0.94
53 0.95
54 0.96
55 0.95
56 0.93
57 0.93
58 0.87
59 0.87
60 0.85
61 0.85
62 0.84
63 0.85
64 0.84
65 0.81