Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IM35

Protein Details
Accession A0A395IM35   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-72SQSHYPIQRKAKQKTQKKSLEIRRRHydrophilic
NLS Segment(s)
PositionSequence
56-72RKAKQKTQKKSLEIRRR
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Amino Acid Sequences MDNKKSKTIYQLDTPFTAVQWPEISSKDQETILELLCSILSPIGTHRSQSHYPIQRKAKQKTQKKSLEIRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.4
3 0.32
4 0.3
5 0.2
6 0.16
7 0.14
8 0.14
9 0.13
10 0.15
11 0.17
12 0.16
13 0.17
14 0.17
15 0.16
16 0.14
17 0.14
18 0.14
19 0.12
20 0.1
21 0.09
22 0.07
23 0.07
24 0.07
25 0.04
26 0.03
27 0.03
28 0.03
29 0.05
30 0.1
31 0.1
32 0.12
33 0.14
34 0.2
35 0.22
36 0.26
37 0.34
38 0.39
39 0.45
40 0.52
41 0.6
42 0.61
43 0.69
44 0.73
45 0.74
46 0.75
47 0.79
48 0.81
49 0.82
50 0.84
51 0.83
52 0.86