Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J390

Protein Details
Accession A0A395J390   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-94IGIPMPKKSRGKKRRVATGDBasic
NLS Segment(s)
PositionSequence
80-89PKKSRGKKRR
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027421  DNA_pol_lamdba_lyase_dom_sf  
Amino Acid Sequences MNAEIRCFLKWLEEWVVEAQERGYRSLPALKKAHDSIKGCPQRFDHPSEAISLNGIGEGLAKRLTDSLEKYCNEIGIPMPKKSRGKKRRVATGDENGDESATPSVSPKKERLNLIFQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.23
5 0.22
6 0.18
7 0.16
8 0.16
9 0.16
10 0.16
11 0.14
12 0.16
13 0.24
14 0.26
15 0.31
16 0.33
17 0.33
18 0.37
19 0.4
20 0.44
21 0.42
22 0.42
23 0.39
24 0.46
25 0.52
26 0.48
27 0.47
28 0.45
29 0.45
30 0.46
31 0.47
32 0.4
33 0.33
34 0.33
35 0.33
36 0.3
37 0.23
38 0.19
39 0.14
40 0.1
41 0.07
42 0.07
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.06
51 0.07
52 0.08
53 0.11
54 0.14
55 0.19
56 0.2
57 0.22
58 0.22
59 0.21
60 0.18
61 0.17
62 0.15
63 0.19
64 0.21
65 0.23
66 0.25
67 0.31
68 0.39
69 0.48
70 0.57
71 0.58
72 0.65
73 0.72
74 0.77
75 0.81
76 0.79
77 0.78
78 0.75
79 0.74
80 0.7
81 0.61
82 0.55
83 0.44
84 0.39
85 0.31
86 0.24
87 0.15
88 0.09
89 0.08
90 0.1
91 0.17
92 0.21
93 0.26
94 0.31
95 0.4
96 0.46
97 0.54
98 0.57