Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IXB2

Protein Details
Accession A0A395IXB2   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-84DDKEDKCKGCVKKEKKKKAKQDDKDRNSAGGBasic
NLS Segment(s)
PositionSequence
65-73KKEKKKKAK
Subcellular Location(s) nucl 15.5, mito_nucl 12.333, cyto_nucl 10.166, mito 7
Family & Domain DBs
Amino Acid Sequences MSPVSWRVDNSGNVKGLIRRKCDPNPMNWGHHVDKKILNHPEIYKIKTNVEKPDDKEDKCKGCVKKEKKKKAKQDDKDRNSAGGCVVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.38
4 0.39
5 0.4
6 0.39
7 0.46
8 0.5
9 0.6
10 0.57
11 0.55
12 0.59
13 0.58
14 0.56
15 0.52
16 0.52
17 0.45
18 0.46
19 0.41
20 0.35
21 0.34
22 0.33
23 0.37
24 0.35
25 0.32
26 0.31
27 0.3
28 0.36
29 0.35
30 0.35
31 0.31
32 0.29
33 0.32
34 0.34
35 0.36
36 0.34
37 0.37
38 0.39
39 0.38
40 0.47
41 0.5
42 0.46
43 0.5
44 0.5
45 0.49
46 0.48
47 0.52
48 0.47
49 0.51
50 0.6
51 0.64
52 0.68
53 0.75
54 0.82
55 0.86
56 0.91
57 0.92
58 0.93
59 0.94
60 0.94
61 0.94
62 0.94
63 0.91
64 0.9
65 0.81
66 0.73
67 0.63
68 0.53